Entry information : LuDiOx200(Lus10039436|PACid:23175557)
Entry ID 12044
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuDiOx200(Lus10039436|PACid:23175557)
Name LuDiOx200(Lus10039436|PACid:23175557)
Class Alpha-dioxygenase    [Orthogroup: DiOx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuDiOx200
start..stop
S start..stop
CclDiOx02 964 0 8..640 3..638
VvDiOx02 940 0 16..640 15..637
NatDiOx01 939 0 1..640 1..641
VvDiOx01 934 0 16..640 19..641
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1625494..1625604 111 N° 2 1625727..1626002 276 N° 3 1626091..1626240 150 N° 4 1626607..1626740 134
N° 5 1626828..1627041 214 N° 6 1627132..1627277 146 N° 7 1627372..1627593 222 N° 8 1627672..1627874 203
N° 9 1628032..1628275 244 N° 10 1628364..1628586 223  
join(1625494..1625604,1625727..1626002,1626091..1626240,1626607..1626740,1626828 ..1627041,1627132..1627277,1627372..1627593,1627672..1627874,1628032..1628275,16 28364..1628586)


exon

Literature and cross-references LuDiOx200(Lus10039436|PACid:23175557)
DNA ref. Phytozome 12:   scaffold33 (1625494..1628586)
Protein sequence: LuDiOx200(Lus10039436|PACid:23175557)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   641
PWM (Da):   %s   73027.21  
PI (pH):   %s   8.28
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSLFAGYCKTLITKFIHQDFHGVVGKMKLLDAFVFLIVHSMDKKGLWHRLPVFMGLIYLELRRHLHQSYNLINVGKSSNATAGVGGFNPADYPYRTADGKYNDPKDQNAGSQYTLFGRNVMPVDQDDKILRPHPAEVASKLLSRREYKDTGKQFNMVAASWIQFMIHDWIDHLEDTKQMELIAPKDIESQCPLSSFKFYLTKQVTTGLDDIKTGTINARTSWWDGSGIYGSDASKLEKVRVFKDGKLKLGENGLLVVDEDGFAVSGEIRNSWSGVSAIHALFTMEHNSVCDMLKKENPGMGDEELYRRARLVTSAVIAKVHTIDWTVELLKTDTLLAGMRINWYGVLGKWFKDKFGHVGDPRLGGLVGLKQPQNHGVPYSLTEEFVSVYRMHPILPDEFLIRDISSITNKSLPVVEKLPVQNLLGSNGEKALSKIGFTKQMVSMGHQACGALELWNYPNWLRNVAPHDPNGRPRPDHVDLPALEVYRDRERKVARYNEFRRRMLMIPISKWEDLTDDKEAIRVLTEVYGDRMEELDLLVGMMAEKKIKGFAISETAFFIFVMMASRRLEADRFFTSYFNEETYTKKGMAWVNTTESLKDVIDRHYPGMTEKWMKSTSAFTVWDAPPEPYNPIPLYLRIP*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCATCATTGTTTGCTGGGTATTGTAAAACCTTGATCACAAAGTTTATCCACCAGGATTTTCATGGGGTCGTCGGAAAGATGAAGCTGCTCGATGCTTTCGTGTTTTTAGTAAGAATC
TCTTCTTCTTTTTCTCTTTCTCCATGGTTAACAATTAAGATGATGATGATGAGCTTATTTATAATGATCAAAGTTACGTTCATGTTGAGTACTGTTGGTATATATGCATGCAGATTGTGC
ATTCCATGGATAAGAAGGGTCTATGGCACAGGCTGCCTGTGTTTATGGGTCTCATTTACCTGGAGCTCCGTAGACATCTTCATCAGTCATACAATTTGATCAATGTTGGGAAATCTTCAA
ATGCTACTGCTGGTGTTGGTGGTTTCAATCCAGCTGATTACCCTTATAGGACAGCAGATGGGAAATATAATGATCCCAAGGATCAAAATGCAGGCAGCCAATACACTTTGTTTGGTAGGA
ACGTTATGCCAGTTGATCAGGATGATAAG
GTACAATTGATGAACTCTGCATAGTCAATTACAAGGATTTTCTGTTTTTATCTGATTAAAACAAAAAAGATGTATGTATTTGGTGTAGATT
TTAAGACCACATCCTGCAGAAGTGGCTAGCAAACTGCTGTCAAGAAGAGAATACAAGGATACTGGAAAGCAATTCAACATGGTTGCAGCTTCCTGGATTCAGTTCATGATCCATGACTGG
ATTGATCATTTGGAGGATACCAAACAG
GTTTATCTTTATTATTATTTCCTCAACTAGCTACGTACAGGCAAGCTTTTATTCGTGATATAATTATTCTAAAACAAACTGTACAAGTCCATA
GCAGGACGTTGAGTGTTGGCAGTCGTCTATGTGATATCAAATGTTTACAGTAACTTGCTAGAGATGTTCTAATCCTCCAGATGCTGGTCACCAACTTTATCTTCATCAGATGGAACATAT
GTTTTTTTTCATAAATGATGCAGCAGAAAGTGAAACCCATTACGCAGTGTTTATTTTCATAACAGCAGTTCACAGTTCCCAATTACTGCACCAACCAAGTGCTAGTAAATTAACTTCTCT
TGGAATGTCTTGTTTTTTCTGGTATTTATATAGATGGAACTGATTGCACCCAAAGATATCGAAAGTCAGTGCCCCCTTAGTTCCTTCAAGTTCTATTTGACCAAGCAAGTTACAACTGGG
TTGGATGATATCAAGACTGGTACAATAAATGCACGTACATCCTGGTG
GTATGTATACATGTACAAAACTCAATTCTTATTTATTATTTGATCATGAGTTCCAAGATATTATTTGTAACAA
ACAAATGAATGAAGGGATGGAAGTGGGATTTACGGAAGTGATGCGAGCAAGTTGGAGAAAGTGAGGGTGTTCAAAGATGGGAAGCTCAAGTTAGGTGAGAATGGGCTTCTGGTGGTTGAT
GAAGATGGGTTTGCTGTATCTGGAGAAATTCGTAATTCTTGGTCTGGAGTCTCCGCCATCCATGCCCTTTTCACTATGGAGCATAATTCTGTCTGTGACATGCTCAAG
GTTTCCTTTCCA
TACATAAGATGATCTTGTTGCTCTATATATACCCAACTGCGAACATTTAAACAACTGAAAACATCTTTGGTTGTACAGAAAGAAAACCCAGGGATGGGAGATGAAGAGTTATACAGGCGT
GCAAGACTTGTGACCTCTGCAGTGATTGCAAAGGTTCATACCATTGACTGGACTGTTGAGCTTCTCAAAACTGATACATTACTCGCCGGAATGCGAATCAACTG
GTACGTTTGATTTGTC
TCTGCTGTACTGCAGCTAGGCGCTAGCTGGTTTTTATTTATTCAACTTCACATGTACAATTTGGCCTTGTGCCTGCAGGTATGGAGTACTGGGGAAATGGTTCAAGGACAAATTTGGACA
TGTGGGTGATCCAAGACTGGGAGGACTAGTCGGTTTGAAACAGCCACAAAATCATGGAGTGCCATACTCATTGACTGAGGAATTTGTGAGTGTATACAGAATGCACCCAATTTTGCCTGA
TGAATTCCTCATCAGGGACATTTCTTCGATTACCAACAAGTCTCTTCCGGTTGTTGAAAA
GTTAGTACCATTCTCACCCTATCATCATTACAACAAAAAGATTCCCAATGACTGACTTTC
TTCCTTGTAAATGGACAGGCTGCCCGTTCAAAACTTATTAGGCTCAAATGGGGAAAAGGCATTGTCCAAAATTGGATTCACTAAGCAAATGGTCTCCATGGGTCACCAAGCATGTGGTGC
TCTTGAGCTCTGGAACTACCCCAATTGGCTTAGGAATGTAGCACCCCATGATCCTAATGGCAGACCAAGGCCTGATCATGTCGATCTACCAGCCCTTGAAG
GTACTTGCATGCACCATTT
TAAGATTCTCTACAACTTAAATTCGTAATTTCCCTCCGGTGGCGGATACAAGGGCCTCCCTTAGCCATTGTCATTCCACATCTTGATTGCCCTATTTCTTTACTTCAATTAAAGTTTTAG
TTTATGTTTGTTGAGCAGTATATAGGGACAGAGAGAGGAAAGTTGCAAGGTACAACGAGTTCCGAAGAAGGATGCTGATGATACCAATATCGAAATGGGAAGATCTCACGGATGACAAGG
AAGCTATTCGGGTGCTTACTGAAGTGTACGGTGATCGAATGGAAGAGCTAGACCTTCTAGTTGGAATGATGGCCGAGAAAAAGATCAAAGGGTTTGCTATAAGTGAAACTGCATTCTTCA
TATTTGTCATGATGGCTTCCAG
GTATATTTATAGATAGCCGAGATTAAAAGATCATGCATAAGTTAATATACTCCTGATTAATTAAAATGTTTTTTTTGACTTATTGCAGGAGGCTGGAG
GCGGACAGGTTCTTCACGAGTTATTTCAACGAGGAAACATACACAAAGAAGGGTATGGCATGGGTGAACACAACTGAGTCTCTTAAAGATGTGATTGATCGCCACTATCCTGGAATGACT
GAGAAATGGATGAAGTCTACAAGTGCATTCACTGTTTGGGATGCACCTCCTGAACCTTATAATCCTATTCCTCTTTACCTGCGGATTCCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCATCATTGTTTGCTGGGTATTGTAAAACCTTGATCACAAAGTTTATCCACCAGGATTTTCATGGGGTCGTCGGAAAGATGAAGCTGCTCGATGCTTTCGTGTTTTTAATTGTGCAT
TCCATGGATAAGAAGGGTCTATGGCACAGGCTGCCTGTGTTTATGGGTCTCATTTACCTGGAGCTCCGTAGACATCTTCATCAGTCATACAATTTGATCAATGTTGGGAAATCTTCAAAT
GCTACTGCTGGTGTTGGTGGTTTCAATCCAGCTGATTACCCTTATAGGACAGCAGATGGGAAATATAATGATCCCAAGGATCAAAATGCAGGCAGCCAATACACTTTGTTTGGTAGGAAC
GTTATGCCAGTTGATCAGGATGATAAG
ATTTTAAGACCACATCCTGCAGAAGTGGCTAGCAAACTGCTGTCAAGAAGAGAATACAAGGATACTGGAAAGCAATTCAACATGGTTGCAGCT
TCCTGGATTCAGTTCATGATCCATGACTGGATTGATCATTTGGAGGATACCAAACAG
ATGGAACTGATTGCACCCAAAGATATCGAAAGTCAGTGCCCCCTTAGTTCCTTCAAGTTCTAT
TTGACCAAGCAAGTTACAACTGGGTTGGATGATATCAAGACTGGTACAATAAATGCACGTACATCCTGGTG
GGATGGAAGTGGGATTTACGGAAGTGATGCGAGCAAGTTGGAGAAAGTG
AGGGTGTTCAAAGATGGGAAGCTCAAGTTAGGTGAGAATGGGCTTCTGGTGGTTGATGAAGATGGGTTTGCTGTATCTGGAGAAATTCGTAATTCTTGGTCTGGAGTCTCCGCCATCCAT
GCCCTTTTCACTATGGAGCATAATTCTGTCTGTGACATGCTCAAG
AAAGAAAACCCAGGGATGGGAGATGAAGAGTTATACAGGCGTGCAAGACTTGTGACCTCTGCAGTGATTGCAAAG
GTTCATACCATTGACTGGACTGTTGAGCTTCTCAAAACTGATACATTACTCGCCGGAATGCGAATCAACTG
GTATGGAGTACTGGGGAAATGGTTCAAGGACAAATTTGGACATGTGGGT
GATCCAAGACTGGGAGGACTAGTCGGTTTGAAACAGCCACAAAATCATGGAGTGCCATACTCATTGACTGAGGAATTTGTGAGTGTATACAGAATGCACCCAATTTTGCCTGATGAATTC
CTCATCAGGGACATTTCTTCGATTACCAACAAGTCTCTTCCGGTTGTTGAAAA
GCTGCCCGTTCAAAACTTATTAGGCTCAAATGGGGAAAAGGCATTGTCCAAAATTGGATTCACTAAG
CAAATGGTCTCCATGGGTCACCAAGCATGTGGTGCTCTTGAGCTCTGGAACTACCCCAATTGGCTTAGGAATGTAGCACCCCATGATCCTAATGGCAGACCAAGGCCTGATCATGTCGAT
CTACCAGCCCTTGAAG
TATATAGGGACAGAGAGAGGAAAGTTGCAAGGTACAACGAGTTCCGAAGAAGGATGCTGATGATACCAATATCGAAATGGGAAGATCTCACGGATGACAAGGAA
GCTATTCGGGTGCTTACTGAAGTGTACGGTGATCGAATGGAAGAGCTAGACCTTCTAGTTGGAATGATGGCCGAGAAAAAGATCAAAGGGTTTGCTATAAGTGAAACTGCATTCTTCATA
TTTGTCATGATGGCTTCCAG
GAGGCTGGAGGCGGACAGGTTCTTCACGAGTTATTTCAACGAGGAAACATACACAAAGAAGGGTATGGCATGGGTGAACACAACTGAGTCTCTTAAAGAT
GTGATTGATCGCCACTATCCTGGAATGACTGAGAAATGGATGAAGTCTACAAGTGCATTCACTGTTTGGGATGCACCTCCTGAACCTTATAATCCTATTCCTCTTTACCTGCGGATTCCA
TGA

Retrieve as FASTA