Entry information : LuGPx08(Lus10000601|PACid:23144305)
Entry ID 12045
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuGPx08(Lus10000601|PACid:23144305)
Name LuGPx08(Lus10000601|PACid:23144305)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2004]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuGPx08
start..stop
S start..stop
LuGPx41 311 5e-111 1..163 1..163
NtGPx08-1A 276 3e-97 1..160 1..160
LeGPx08 276 5e-97 1..160 1..160
VvGPx08 275 7e-97 1..160 1..160
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8256..8309 54 N° 2 7933..8009 77 N° 3 7788..7849 62 N° 4 7581..7699 119
N° 5 7321..7500 180  
complement(join(7321..7500,7581..7699,7788..7849,7933..8009,8256..8309))


exon

Literature and cross-references LuGPx08(Lus10000601|PACid:23144305)
DNA ref. Phytozome 11:   scaffold645 (8309..7321)
Protein sequence: LuGPx08(Lus10000601|PACid:23144305)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   164
PWM (Da):   %s   18406.23  
PI (pH):   %s   6.11
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSEEQQSPHSIYDFTVKNAKGHAVSLGIYKGKVLLIINVASKCGMTNSNHTELNALYHKYKDGLEILAFPCNQFGAEEPGNNDEIEEFVCSRFKSEFPIFDIEVNGENASPLYKLLKTGKWGIFGDDIQWNFVKFLVNKQGQVVDRYYPTTSPLSIEVKT*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGAGCGAAGAACAACAGAGCCCGCATTCCATTTACGATTTCACTGTAAAGGTCAGTCTCTTTTGCTTGCTGCTTGACCTTGAGTTCGACCAACGAATCTCTCTCCTTTCTACCTCG
CTACGAATCCTCTTTGATCATTCATTTATGTAAAAGCTACAACCCGTAGAAAAGTTGATGACTTGGGGGTTGTTTCAGATCATACTTTTCTCTTATCTAATCTATGAAGGAAGACTCCAA
TTCTTTAAGCTCGGTTTACTATTCATCCAAGTCCAACCCCAGTTCTTTTGACTGGTGCAGAATGCTAAGGGACATGCTGTAAGTCTCGGTATCTACAAGGGGAAGGTCCTGCTTATTATC
AATGTTGCTTCCAAATG
GTAATCCCCATAATAATTATGATTATTGATTTGTCAAGGACCATGTTGAATCCGTTGTTAATTGGCTTTATTTATTTCTGCAGTGGCATGACCAACTCAAACC
ACACGGAGCTGAATGCTTTGTATCACAAGTACAAAGATCAAG
GTTAACAACTTCATTACCTACCTGATAAAAAGTTCCATCTGTGAGAAGATGAATCTTCACTTGATTTCACAAACTGGA
GTAACTGCAGGGTTGGAGATACTGGCATTCCCTTGCAACCAGTTTGGAGCAGAAGAACCAGGAAACAATGACGAGATTGAAGAATTCGTTTGCAGTAGATTCAAGTCCGAGTTCCCCATA
TTCGACAAG
GTACATCTGTTTGGCTGGAGAAAGGGGCATTAGTTGTATATCTATTGTCTCATTTGGAATCTGTTGGTGATCATCATCAGATTGAGGTGAATGGAGAGAATGCATCCCCAC
TGTACAAGTTGTTGAAGACAGGGAAATGGGGAATTTTCGGCGACGACATCCAATGGAACTTTGTCAAGTTCCTTGTCAACAAACAAGGCCAAGTTGTTGATCGTTACTACCCAACAACTT
CTCCCCTAAGCATCGAGGTAAAGACATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGAGCGAAGAACAACAGAGCCCGCATTCCATTTACGATTTCACTGTAAAGAATGCTAAGGGACATGCTGTAAGTCTCGGTATCTACAAGGGGAAGGTCCTGCTTATTATCAATGTT
GCTTCCAAATG
TGGCATGACCAACTCAAACCACACGGAGCTGAATGCTTTGTATCACAAGTACAAAGATCAAGGGTTGGAGATACTGGCATTCCCTTGCAACCAGTTTGGAGCAGAAGAA
CCAGGAAACAATGACGAGATTGAAGAATTCGTTTGCAGTAGATTCAAGTCCGAGTTCCCCATATTCGACAAG
ATTGAGGTGAATGGAGAGAATGCATCCCCACTGTACAAGTTGTTGAAG
ACAGGGAAATGGGGAATTTTCGGCGACGACATCCAATGGAACTTTGTCAAGTTCCTTGTCAACAAACAAGGCCAAGTTGTTGATCGTTACTACCCAACAACTTCTCCCCTAAGCATCGAG
GTAAAGACATAA

Retrieve as FASTA