Entry information : LuGPx09(Lus10000603|PACid:23144300)
Entry ID 12046
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuGPx09(Lus10000603|PACid:23144300)
Name LuGPx09(Lus10000603|PACid:23144300)
Class Plant glutathione peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuGPx09
start..stop
S start..stop
LuGPx40 298 9e-106 1..159 1..159
LuGPx46 274 2e-95 1..159 68..226
LuGPx220 273 5e-95 1..159 70..228
PtGPx06-1 261 4e-91 1..159 1..158
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 27676..27726 51 N° 2 27373..27449 77 N° 3 27145..27206 62 N° 4 26877..26995 119
N° 5 26484..26672 189  
complement(join(26484..26672,26877..26995,27145..27206,27373..27449,27676..27726 ))


exon

Literature and cross-references LuGPx09(Lus10000603|PACid:23144300)
DNA ref. Phytozome 11:   scaffold645 (27726..26484)
Protein sequence: LuGPx09(Lus10000603|PACid:23144300)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   166
PWM (Da):   %s   18687.48  
PI (pH):   %s   8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATNSESRKSIYDFTVKDARGNDVDLSIYKEKVLLIVNVASQCRLTNSNYTELTQLCQKYKDGMEILAFSYNQFGSQELGNNDQIVEFACTRFKAEFPIFDVDVNGKEVAPVYKYLKASKSGIFGDGIKWNFTKFLVNKEGQVVDRYAPTTSPLSIKVPEIAY*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACCAATTCCGAATCTCGTAAGTCCATCTACGACTTCACTGTTAAGGTAATTTTAATCCTAAGTGTGTTGCCTCCTTTGGTCAACGTCTGGATTTTCTGTTTGAATTTAAGTTGT
TGGAGGATGGATGATGCTTTTCTATTTTTTGAGGAGTTGGTTCCGTGGGTTTCTGGTATTGGGTTTAAGCCAAAGAGCTCTTAATACCCCTTGTGGTGGTAGACTGTGTGATATCATTTA
TTTTTGTTATTGACTTCATTTCTGTTTCGTTGTGCAGGATGCTAGAGGGAATGATGTTGATCTCAGTATCTACAAGGAAAAAGTTCTTTTGATCGTTAATGTTGCCTCCCAATGGTAAGT
ATCAGCTTCCCCCTTTTCCTTTTCTTTTTATTGGCTCTGCCATGAATACATAGATATATAGAAGTTCCAGACAAATACAGACAGTTCTGGTTTAGTAGCTAGTGGCTCTACCATCTGGTT
CTCTGCTATGAATTATTAAGCAGTTGGTTTCTTGATGCAGCAGATTGACCAATTCCAACTACACTGAGCTGACTCAGTTATGCCAGAAATACAAAGATCAAGGTTTTCTCTTGACCCTTC
TTCCCGATTTTTGCACTCTTTCACCTTTTATGTTCAGTCACATAAGACTGTACGAGTTCATCCTTTTTCATGTCGTTGCAAATGTTGTATGATGTGGAAGATGATTCTCTCTTAACTGTT
CTCGGGAGCAGGTATGGAGATCTTGGCATTTTCTTACAATCAGTTTGGGTCTCAGGAACTAGGCAACAATGATCAAATTGTGGAGTTTGCTTGTACTCGTTTCAAGGCCGAGTTCCCCAT
ATTCGACAAG
GTAGACTCCATATTCTTACTTGATATCTTAAGTTAACTCAAGGACAATGAATCAGTGAGCCTTATGCATAACCATTGACTGATCAAGTAAGATTGATTCTTTTATGAAAT
GTTTTGGGGTGTTGGTCTATAACCCAACGTTCAGAAAAACTTGTATAGTATAAATCAACTCGTGGTTGAACTATTGTTGATAAATTGGTACAAGGTTGATGTGAATGGAAAAGAGGTTGC
TCCAGTCTACAAGTACCTCAAGGCGAGCAAAAGTGGAATCTTTGGGGATGGTATCAAGTGGAACTTCACCAAGTTCCTCGTCAACAAAGAGGGTCAGGTGGTTGATCGCTACGCTCCTAC
CACCTCCCCTCTCAGCATTAAGGTACCGGAAATCGCTTACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACCAATTCCGAATCTCGTAAGTCCATCTACGACTTCACTGTTAAGGATGCTAGAGGGAATGATGTTGATCTCAGTATCTACAAGGAAAAAGTTCTTTTGATCGTTAATGTTGCC
TCCCAATG
CAGATTGACCAATTCCAACTACACTGAGCTGACTCAGTTATGCCAGAAATACAAAGATCAAGGTATGGAGATCTTGGCATTTTCTTACAATCAGTTTGGGTCTCAGGAACTA
GGCAACAATGATCAAATTGTGGAGTTTGCTTGTACTCGTTTCAAGGCCGAGTTCCCCATATTCGACAAG
GTTGATGTGAATGGAAAAGAGGTTGCTCCAGTCTACAAGTACCTCAAGGCG
AGCAAAAGTGGAATCTTTGGGGATGGTATCAAGTGGAACTTCACCAAGTTCCTCGTCAACAAAGAGGGTCAGGTGGTTGATCGCTACGCTCCTACCACCTCCCCTCTCAGCATTAAGGTA
CCGGAAATCGCTTACTAG

Retrieve as FASTA