Entry information : LuGPx142(Lus10027021|PACid:23151526)
Entry ID 12048
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuGPx142(Lus10027021|PACid:23151526)
Name LuGPx142(Lus10027021|PACid:23151526)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2003]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuGPx142
start..stop
S start..stop
LuGPx221 321 1e-114 10..169 11..170
PtGPx02 293 2e-103 1..168 1..164
CclGPx02 282 8e-99 10..168 43..201
ThasGPx03 280 6e-98 1..171 32..198
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 113484..113540 57 N° 2 113639..113715 77 N° 3 114691..114752 62 N° 4 115223..115341 119
N° 5 115429..115635 207  
join(113484..113540,113639..113715,114691..114752,115223..115341,115429..115635)


exon

Literature and cross-references LuGPx142(Lus10027021|PACid:23151526)
DNA ref. Phytozome 11:   scaffold297 (113484..115635)
Protein sequence: LuGPx142(Lus10027021|PACid:23151526)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   174
PWM (Da):   %s   19302.96  
PI (pH):   %s   5.97
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MADSSSLLPPNSIYDFTVKDIKGSDVNLSEYKGKVLLIVNVASKCGLTHANYKELNVLYQKYKDGLEILAFPCNQFGGQEPGTIDEIQDTVCTIFKAEFPIFDVDVNGKNTAEVYKYLKSEKGGFLGDAIKWNFTKFLVNKQGKVMERYAPTTSPLKIEKDIQNLLEIASA*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGATTCTTCTTCTCTTTTACCTCCCAACTCCATCTATGACTTCACTGTTAAGGTATTATTAATTCTCCTTTCTGGGTTTCTTCACAGTTGCAGTTGGGTTTGGATGAGAATCTGT
AATTTTACTCTGTTTCTTATCCATGGATTTTGCAGGATATAAAGGGGAGTGATGTGAATCTGAGTGAATACAAGGGGAAGGTTCTTCTCATCGTCAATGTTGCTTCCAAATGGTAGTTAA
CTTCACTATTTCACTCAAATTCGTGATCTTCATCTTTTCTGGTACATGACTTGCAGAGATTTCGGTAACGTTTGACATTTAGATGTCAAACCTTACCGTTATTTCAGTTCCATTACTTCC
ATATAGCATCACCCAATTGAATTGATAAACAATCAAAATGTTTCGGATATATATGTTTCATGATTAGGATGGATAACAGTCAATCTCGTCTGCTAATTATTACACTCATCAGTTGTAATC
TGTCAGAATCTCCCATGGCATTGGTACACAGTAATGAACTAGTTTGACCAAGTGTCCAGAAAAGAAACCCAGTATGCACACTTAGCTGGCATGAATTGCCATTTTCAGAGTTATGTTTTT
GGGGAGCAGATGGTTTTGGATTATGCATGTATTTGGAAGGAAATGAACTGTAAGAGTGCTCCCCAAACCTCAAGGTGTGATATAGCTTATTAGGACCATTGTACCCACTTGCTGATAAGA
GTTTAAACGACTGACGAAGATACATTTGCGAGTTTGATCATATCGATCCTCCTTTACGTCTGTCATAGCTAAGAAAGTGTCTTCTTGCTGTTTAAGTCGATGTATCGGAGAGAAACTCCG
GAAAGATAGAAACTTGGTTGTTGGTTTGCCGTGCAAATTAAAGGAAATCTCTTATTTGAGAATTTGAGTTTATGAGGTGTGAATGGGTTGTGGTGTGTGAATCATCTTGTTCGACTAACC
AGTTATTCAATATGGAGTTTGCTTTAGCACCAACACGTCTGTCGTAGCTAACAATGTCTGGGCTTGCTGTTTAAGCCAATGGGGTCGGAAAGAAACTCCGGAAAGATCGAAACTTGGTTG
TTGTTTCCGCAATGGAAGTTGAAGGAAATCTATGGTTCTAAGCCTGATGTTTTGTCATGCTTGGTTAGAGTTTGTATTTGCACCAACTGGGTATTTGATTGGTTTTAACAACTCTGCACA
CTTTCAGTGGGTTGACACACGCAAACTACAAGGAATTGAACGTGCTATACCAGAAATACAAAGACCAAGGTTAGTCCTGCAATCAACTTTAACGGGTTTAACGGGTTGTTTGGATGAGTT
ATTTTTGGTGGGTGGTATTGTGGAGCAAAATGATGCATTAATTATTTGAGAATGTGAGTTTATGAGGTGTCAATGGGTGTGAATCATCTTGTTCGACTAACCAGTTATTCAATATGGTGT
TTGATAATGCCAAAATAGTCGAAATATCATGGTATTTCCACTACTTTAGGGGAAGGTATTTGAAACAACGGGAAAGTAAATTATTCTAATACCACAACCCGAAATATAAGAGATTTTGTC
GTCGATGCAAAATCAGTTATTTTGAAAGTGAGTTATTTGAAATATCACGGTCGCAAATGCCACAAATTTTGTGTTGGAAGCGAAATGAGTTATTTTGTCCCAAATAAATCATCGAAACGA
CTCCTAAAAGGAAAACATAAAACTTATCCTTCTCAAAAATTGGTAATGAGCTATCTCAGGGCTAGAGATCCTAGCATTCCCTTGCAACCAGTTTGGTGGACAAGAACCAGGAACCATTGA
CGAAATCCAGGACACTGTATGCACCATCTTCAAAGCTGAATTCCCAATCTTTGACAAG
GTAGAGTCTTTTTCTTGTACGTTCCTCGATATAGATGAAATATCGACCGCCCAAAACGTGAC
ATATTCTGGGGTTGGGTTTTTGCAGGTCGATGTGAACGGGAAGAACACTGCGGAGGTGTACAAGTACTTGAAGTCGGAGAAAGGAGGGTTTCTGGGAGATGCAATCAAATGGAACTTCAC
AAAGTTCCTGGTGAACAAACAAGGCAAAGTCATGGAGCGTTACGCTCCCACTACTTCGCCTCTTAAGATCGAGAAGGATATCCAGAACCTGTTGGAAATTGCTTCTGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGATTCTTCTTCTCTTTTACCTCCCAACTCCATCTATGACTTCACTGTTAAGGATATAAAGGGGAGTGATGTGAATCTGAGTGAATACAAGGGGAAGGTTCTTCTCATCGTCAAT
GTTGCTTCCAAATG
TGGGTTGACACACGCAAACTACAAGGAATTGAACGTGCTATACCAGAAATACAAAGACCAAGGGCTAGAGATCCTAGCATTCCCTTGCAACCAGTTTGGTGGACAA
GAACCAGGAACCATTGACGAAATCCAGGACACTGTATGCACCATCTTCAAAGCTGAATTCCCAATCTTTGACAAG
GTCGATGTGAACGGGAAGAACACTGCGGAGGTGTACAAGTACTTG
AAGTCGGAGAAAGGAGGGTTTCTGGGAGATGCAATCAAATGGAACTTCACAAAGTTCCTGGTGAACAAACAAGGCAAAGTCATGGAGCGTTACGCTCCCACTACTTCGCCTCTTAAGATC
GAGAAGGATATCCAGAACCTGTTGGAAATTGCTTCTGCTTGA

Retrieve as FASTA