Entry information : LuGPx211(Lus10042418|PACid:23153616)
Entry ID 12050
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuGPx211(Lus10042418|PACid:23153616)
Name LuGPx211(Lus10042418|PACid:23153616)
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuGPx211
start..stop
S start..stop
LuGPx140 374 2e-133 1..241 1..244
PtGPx01 360 5e-128 18..241 1..232
CsGPx01 358 5e-127 1..241 1..245
LuGPx19 358 1e-125 1..232 1..235
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2078742..2079011 270 N° 2 2079283..2079359 77 N° 3 2079430..2079491 62 N° 4 2079561..2079679 119
N° 5 2079774..2079941 168 N° 6 2080099..2080128 30  
join(2078742..2079011,2079283..2079359,2079430..2079491,2079561..2079679,2079774 ..2079941,2080099..2080128)


exon

Literature and cross-references LuGPx211(Lus10042418|PACid:23153616)
DNA ref. Phytozome 11:   scaffold123 (2078742..2080128)
Protein sequence: LuGPx211(Lus10042418|PACid:23153616)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   242
PWM (Da):   %s   26221.48  
PI (pH):   %s   9.62
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSLPFATAFTSPLHNISEMARSCSPWQSLGVSSGSIRLSLLGSSRSGFLQQGFSLQSQNLAGFVAKSRSFGVFARASTEKSIHDFTVKDIDGTDVALSKFKGKVLLIVNVASRCGLTSSNYSELSQIYDKYKTGLEILAFPCNQFGGQEPGSNPEIKNFACSRFKAEFPIFDVDVNGPNTAPVYQFLKSNGGGILGDLIKWNFEKFLVDKNGKVVQRYPPTTSPLQIEKDIQKLLAA*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTCTTTGCCGTTCGCTACAGCTTTCACTTCACCTTTGCACAACATTTCAGAAATGGCAAGGTCTTGTTCTCCATGGCAGTCGTTAGGTGTTTCTAGTGGATCAATTAGGTTA
TCTCTACTCGGGTCTTCTAGATCCGGGTTTCTGCAACAAGGGTTCTCGTTGCAGTCCCAGAATTTAGCTGGGTTTGTTGCAAAGTCTCGATCTTTTGGTGTTTTCGCCCGCGCCTCCACC
GAAAAATCCATTCATGACTTTACTGTCAAG
GTACGTTTTAGGCAATGGATGAGGCACTGCTTCAGTGTGCGAACGCCTACCTTTTTGCAGTTCAATTGAGGGCTTCTGTGGGGTTTTCTG
TTGGTTTTAGAATGAACTTAGACTGGGTGAGTAAGTATGATCCCTGTTGCTGTTATTACTGTTCGAAAGGAAGATTCTTGAACTTATCCAAGCTGTGTAGTGATGTAAACGGGTAACTCA
GTTTCAGCTTATTTATGTATGCAACTGAAACTGATAAAGTGTTGCCATTTTGGTGTGCCAGGATATTGATGGTACCGATGTGGCTCTTAGCAAATTCAAGGGAAAAGTTCTTTTGATTGT
CAATGTAGCCTCCAGATG
GTATTAATTTCCTGAGTAATCCATACTTTATCCAGCTAAGAATTATCATTTTATTATTGTTTGATTGCAGTGGTTTGACATCATCCAACTATTCAGAACTGT
CCCAGATTTATGACAAGTACAAGACCCAGG
GTAAGAAAACCCCCACATAAACAAACTCTTGTATTCAAAAAATTCATGCTCTGTACTGTTTCATTGCAGGACTTGAAATACTAGCATTCC
CTTGCAATCAGTTTGGAGGCCAAGAACCAGGATCGAATCCAGAGATCAAGAATTTCGCATGTAGCAGATTCAAAGCTGAATTTCCTATATTTGATAAG
GTAATTAATCCACCTGGGTTCT
CATCCTTTTTCTGTGTTGCTATCATATCATGTCGCAAGCGGAGGATGAACATTTCAGAATTTGTGACTGTAGGTTGACGTGAATGGACCAAACACAGCCCCAGTTTACCAGTTTTTGAAG
TCCAACGGTGGTGGGATTTTAGGGGATTTGATCAAGTGGAATTTTGAGAAGTTCTTGGTGGACAAGAACGGTAAGGTTGTCCAACGGTATCCACCAACAACATCACCTCTCCAAATTGAG
GTATAGCTACGACTCAGTGGCAAATTGCTTAGTTCTTGGCGCATTTCAATATGATACTCTTTTCTTACTCATTTTATGGCTCTCAAAACTTGAAATCAGAATCAGTCAGCTGGTTAAAAG
ATATGCCTTCCTGAAAGTTTGGATCTTTGTGTTGCAGAAGGATATTCAGAAACTGCTGGCGGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTCTTTGCCGTTCGCTACAGCTTTCACTTCACCTTTGCACAACATTTCAGAAATGGCAAGGTCTTGTTCTCCATGGCAGTCGTTAGGTGTTTCTAGTGGATCAATTAGGTTA
TCTCTACTCGGGTCTTCTAGATCCGGGTTTCTGCAACAAGGGTTCTCGTTGCAGTCCCAGAATTTAGCTGGGTTTGTTGCAAAGTCTCGATCTTTTGGTGTTTTCGCCCGCGCCTCCACC
GAAAAATCCATTCATGACTTTACTGTCAAG
GATATTGATGGTACCGATGTGGCTCTTAGCAAATTCAAGGGAAAAGTTCTTTTGATTGTCAATGTAGCCTCCAGATGTGGTTTGACATCA
TCCAACTATTCAGAACTGTCCCAGATTTATGACAAGTACAAGACCCAGG
GACTTGAAATACTAGCATTCCCTTGCAATCAGTTTGGAGGCCAAGAACCAGGATCGAATCCAGAGATCAAG
AATTTCGCATGTAGCAGATTCAAAGCTGAATTTCCTATATTTGATAAG
GTTGACGTGAATGGACCAAACACAGCCCCAGTTTACCAGTTTTTGAAGTCCAACGGTGGTGGGATTTTAGGG
GATTTGATCAAGTGGAATTTTGAGAAGTTCTTGGTGGACAAGAACGGTAAGGTTGTCCAACGGTATCCACCAACAACATCACCTCTCCAAATTGAG
AAGGATATTCAGAAACTGCTGGCG
GCTTAA

Retrieve as FASTA