Entry information : LuGPx40(Lus10008022|PACid:23161769)
Entry ID 12052
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuGPx40(Lus10008022|PACid:23161769)
Name LuGPx40(Lus10008022|PACid:23161769)
Class Plant glutathione peroxidase     [Orthogroup: Gpx2001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuGPx40
start..stop
S start..stop
LuGPx220 321 2e-113 1..169 70..238
LuGPx46 320 2e-113 1..169 68..236
AlyGPx06 308 1e-108 1..170 67..235
PtGPx06-1 305 1e-108 1..169 1..168
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 265877..265927 51 N° 2 266175..266251 77 N° 3 266409..266470 62 N° 4 266612..266730 119
N° 5 266945..267112 168 N° 6 267256..267297 42  
join(265877..265927,266175..266251,266409..266470,266612..266730,266945..267112, 267256..267297)


exon

Literature and cross-references LuGPx40(Lus10008022|PACid:23161769)
DNA ref. Phytozome 11:   scaffold517 (265877..267297)
Protein sequence: LuGPx40(Lus10008022|PACid:23161769)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   172
PWM (Da):   %s   19160.77  
PI (pH):   %s   8.42
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATNSDSPKSIYDFTVKDARGNDVDLSIYKGKVLLIVNVASQCGLTNSNYTELTQLYQKYKDGMEILAFPCNQFGSQEPGNNDQIVEFACTRFKAEFPIFDVDVNGKEAAPIYKYLKASKGGLFGDGIKWNFTKFLVNKEGQVVDRYAPTTSPLSIEKDVKKLLGITSKQ*

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction. 5' end is missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACCAATTCCGACTCTCCTAAGTCCATCTACGACTTCACTGTCAAGGTATTTTTAATCAAATTCAAAATTGTGTTGCCTCCCTCCTTTAACGTCTGGATTTTCTGTTTGAATTTA
GTTGTTGGAGGATGATGCTTTCCAATTTTATGAGGAGTTGGGTTTCCGTGGGTTTCTATTCTTGGGTTTAAGCCAAAGGGCTCTTCTTGACTTCTGTGGTGAATGAATACCTGTTGACTA
TTGTGTGATATCATTTATTTTTTCTTCTAATTAATTTAGTTTCTGTTGCGTTGTGCAGGATGCTAGAGGGAATGATGTTGATCTCAGTATTTATAAGGGAAAAGTTCTGTTGATTGTTAA
TGTTGCCTCCCAATG
GTGATTAATCACCTTTCCTCTTTTCCTTTCCTTTTTTTTATTAATACATAGAGGCAGAAATTCCACACAAATATGGACAGTTCTGGTTTAGTAGCTAAGTGGCTT
CACCATCTGGTTTTCTGCTATGAATTATTAACCTGTTGGTTTCTTGATGCAGTGGATTGACCAATTCCAACTATACTGAGTTGACTCAACTGTACCAGAAATACAAAGATCAAGGTTTCC
TCTTGACCCTTCTTCCCGGTTTTTGCATTCTTTCACCTTTATGTTCACTCACATAAGACTTCATCCTTTTTTCATGACGTTGCAAATGTTGTATGATGTGGATGGTGAATTTCTCTTAAC
TCTTCTTGCGAGCAGGTATGGAGATCTTGGCTTTTCCTTGCAATCAGTTCGGGTCTCAGGAACCAGGCAACAATGATCAAATTGTGGAGTTTGCTTGTACTCGTTTCAAGGCCGAGTTCC
CCATATTCGATAAG
GTAGGCTCCATATTCTTACTTGATATATATCTGAAGTTAACTCAAGGACAGTGAATCAATGAGCCTTATGCATAACCACCAACGGATCAAATAAGATTGATTATTT
TATGAAATGTTTTGGGGGTGTTGGTCTATAACCCAACGTTCAGAAAAACTTGTCTAGTATACTATAAATCAACTCGTGGTTGAACAATTGTTGATAAATTGGTACAAGGTTGATGTGAAT
GGAAAAGAGGCTGCTCCAATCTACAAGTACCTCAAGGCGAGCAAAGGTGGACTCTTTGGGGATGGTATCAAGTGGAACTTCACCAAGTTCCTCGTCAACAAAGAGGGTCAGGTGGTCGAT
CGCTATGCTCCTACCACCTCCCCTCTCAGCATTGAG
GTACTGGAAATCGCTTACTAGACACTCACTGATTCCTCATCTGTCAATCTGTTTGGAGTTGTTTCAATGCCAGGTTATATTACT
AAATACTAACAGAACCTTATGTTGGTTATGTATCTTTTTCTATGTGTCTGTATTTGTAGAAAGATGTGAAGAAGCTGCTTGGGATTACATCGAAGCAATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACCAATTCCGACTCTCCTAAGTCCATCTACGACTTCACTGTCAAGGATGCTAGAGGGAATGATGTTGATCTCAGTATTTATAAGGGAAAAGTTCTGTTGATTGTTAATGTTGCC
TCCCAATG
TGGATTGACCAATTCCAACTATACTGAGTTGACTCAACTGTACCAGAAATACAAAGATCAAGGTATGGAGATCTTGGCTTTTCCTTGCAATCAGTTCGGGTCTCAGGAACCA
GGCAACAATGATCAAATTGTGGAGTTTGCTTGTACTCGTTTCAAGGCCGAGTTCCCCATATTCGATAAG
GTTGATGTGAATGGAAAAGAGGCTGCTCCAATCTACAAGTACCTCAAGGCG
AGCAAAGGTGGACTCTTTGGGGATGGTATCAAGTGGAACTTCACCAAGTTCCTCGTCAACAAAGAGGGTCAGGTGGTCGATCGCTATGCTCCTACCACCTCCCCTCTCAGCATTGAG
AAA
GATGTGAAGAAGCTGCTTGGGATTACATCGAAGCAATGA

Retrieve as FASTA