Entry information : LuPrx100 (Lus10018375|PACid:23162118)
Entry ID 12064
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-05 (Christophe Dunand)
Peroxidase information: LuPrx100 (Lus10018375|PACid:23162118)
Name (synonym) LuPrx100 (Lus10018375|PACid:23162118)
Class Class III peroxidase    [Orthogroup: Prx066]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx100
start..stop
S start..stop
EgrPrx74 451 4e-161 21..327 11..317
EcamPrx74 451 8e-161 21..327 25..331
EglPrx74 449 2e-160 21..327 11..317
AcoPrx52 427 1e-151 18..327 19..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 134118..134318 201 N° 2 133528..133876 349 N° 3 132758..133191 434  
complement(join(132758..133191,133528..133876,134118..134318))


exon

Literature and cross-references LuPrx100 (Lus10018375|PACid:23162118)
DNA ref. Phytozome 11:   scaffold251 (134318..132758)
Protein sequence: LuPrx100 (Lus10018375|PACid:23162118)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (307)
PWM (Da):   %s   35755.29 (33461.0)  
PI (pH):   %s   8.81 (8.81) Peptide Signal:   %s   cut: 21 range:21-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAIALLFLIKFLVAFSTTEASLELHFYRNSCPQAEAIVKSAMKRHFNRDPSVPAGLLRLHFHDCFIRGCDGSVLIDSRGGNRAEKEAPPNLTLRGFEVIDDIKAKLERQCPGIVSCADTLALATRDGVALSGGSSYGLPTGRRDGTVSDVKEVHIPGPSVSISDALTALEPLNLGLDDLTTLLGAHSIGFCHCAFFIGRLYNFRGSGRPDPNMDPTLVSTLRTKCPRPGPNESFNVSTDPKVFMNPTSESPFRLDSSFYDNVMNQESVLHLDQQLAFTDITRKTASLYSSRPKVFRKRFAKAMVKLGNVGVLTGSAGEIRRNCRRVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 3).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTATAGCTTTGCTTTTCCTCATCAAGTTCCTTGTTGCATTCTCAACAACAGAAGCATCACTAGAGCTTCATTTCTACAGAAATTCATGCCCCCAAGCCGAAGCCATAGTCAAGAGC
GCGATGAAGCGACATTTCAATAGGGACCCCTCGGTCCCTGCTGGCTTGCTCCGGTTGCATTTCCACGATTGCTTCATTCGT
GTAAGTTTAGTAATTTGGTGTTGTTATGGATCATTGTGT
CCCGATAACTCTGGTCGTTGGGAAAACGTTCGATGTTGGCTTTGTGATCAGTAAATTTGGTGTAACAGACGCTACGTACTAGGATTTAATACTTCGACTGTTGAGTTAAAATTGGTTTTA
CATTATTCATTAACTCCCGTAAGACTTGTGCAAAGTTCGAGTTTTTTGTCACTAAAGATTGAATTTGTTTCTTCTAATGTAGGGTTGTGACGGGTCAGTTCTGATCGACAGCAGAGGAGG
AAACAGAGCCGAGAAGGAAGCTCCACCAAACCTAACACTTAGAGGCTTCGAAGTTATCGACGACATCAAGGCCAAGTTGGAGAGACAGTGTCCAGGAATTGTGTCGTGCGCTGACACTTT
GGCACTTGCGACTAGAGACGGCGTCGCATTGTCCGGCGGCTCGTCCTATGGTCTCCCTACCGGGAGAAGAGACGGGACTGTTTCGGATGTCAAAGAGGTTCATATTCCGGGGCCCTCAGT
CTCGATTTCAGATGCATTAACCGCGCTCGAACCGCTTAATCTCGGACTAGACGATCTCACCACATTGCTAG
GTAAGTCCCGAATCCAAATCTTAAACCTTAATCATCTTAACCAACTCTT
TAATTTCATAAAATTATTTTAAATAAGTAGTAGAATTGCCTTATTTTTTCACCATTTCATCACTAAAAGTTATTAGTGACCGTTTTAACTTATTAATAATTGTAACTAGAGTTTTAGACT
TGTTTTGGACGCGTCTATAAAACTGTGTTTTGTTTTATATAAAAAAGATTATTTGTCGACACTTGCAAGCACAATGTCATGTTTATATAATCTGATCCAGTATTCAAACCATTCTACACC
CGCAACCCGGTTTAATAAAAACCGATTCCTTGACTTTTTCTCTTCAGGTGCTCACAGCATAGGATTCTGCCACTGTGCATTCTTCATCGGCCGGCTATACAACTTCAGGGGAAGCGGCCG
GCCCGACCCGAACATGGACCCAACCCTTGTCTCTACTCTACGGACCAAATGTCCACGACCCGGTCCGAACGAGTCGTTCAACGTAAGCACCGACCCGAAAGTGTTCATGAATCCGACGAG
CGAATCTCCGTTCAGGCTGGACAGCTCGTTCTACGACAATGTGATGAACCAGGAATCGGTTCTCCACCTCGATCAGCAGCTGGCCTTCACTGACATCACGCGTAAAACGGCCTCGCTTTA
CTCCAGCCGGCCGAAGGTGTTTAGGAAGAGGTTTGCTAAGGCGATGGTTAAGCTTGGGAACGTTGGGGTTTTGACCGGGTCGGCCGGAGAGATTAGGCGTAATTGTAGACGCGTTAATTA
A

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTATAGCTTTGCTTTTCCTCATCAAGTTCCTTGTTGCATTCTCAACAACAGAAGCATCACTAGAGCTTCATTTCTACAGAAATTCATGCCCCCAAGCCGAAGCCATAGTCAAGAGC
GCGATGAAGCGACATTTCAATAGGGACCCCTCGGTCCCTGCTGGCTTGCTCCGGTTGCATTTCCACGATTGCTTCATTCGT
GGTTGTGACGGGTCAGTTCTGATCGACAGCAGAGGAGGA
AACAGAGCCGAGAAGGAAGCTCCACCAAACCTAACACTTAGAGGCTTCGAAGTTATCGACGACATCAAGGCCAAGTTGGAGAGACAGTGTCCAGGAATTGTGTCGTGCGCTGACACTTTG
GCACTTGCGACTAGAGACGGCGTCGCATTGTCCGGCGGCTCGTCCTATGGTCTCCCTACCGGGAGAAGAGACGGGACTGTTTCGGATGTCAAAGAGGTTCATATTCCGGGGCCCTCAGTC
TCGATTTCAGATGCATTAACCGCGCTCGAACCGCTTAATCTCGGACTAGACGATCTCACCACATTGCTAG
GTGCTCACAGCATAGGATTCTGCCACTGTGCATTCTTCATCGGCCGGCTA
TACAACTTCAGGGGAAGCGGCCGGCCCGACCCGAACATGGACCCAACCCTTGTCTCTACTCTACGGACCAAATGTCCACGACCCGGTCCGAACGAGTCGTTCAACGTAAGCACCGACCCG
AAAGTGTTCATGAATCCGACGAGCGAATCTCCGTTCAGGCTGGACAGCTCGTTCTACGACAATGTGATGAACCAGGAATCGGTTCTCCACCTCGATCAGCAGCTGGCCTTCACTGACATC
ACGCGTAAAACGGCCTCGCTTTACTCCAGCCGGCCGAAGGTGTTTAGGAAGAGGTTTGCTAAGGCGATGGTTAAGCTTGGGAACGTTGGGGTTTTGACCGGGTCGGCCGGAGAGATTAGG
CGTAATTGTAGACGCGTTAATTAA

Retrieve as FASTA