Entry information : LuPrx138(Lus10025737|PACid:23177517)
Entry ID 12088
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-30 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2013-05-28 (Qiang Li)
Peroxidase information: LuPrx138(Lus10025737|PACid:23177517)
Name LuPrx138(Lus10025737|PACid:23177517)
Class Class III peroxidase     [Orthogroup: Prx019]*
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx138
start..stop
S start..stop
LuPrx192 357 4e-126 1..186 136..344
RcPrx30 274 2e-93 1..184 124..329
MePrx63 272 8e-93 1..175 121..319
CclPrx39 272 1e-92 1..172 121..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 194649..194675 27 N° 2 194422..194562 141 N° 3 193920..194312 393  
complement(join(193920..194312,194422..194562,194649..194675))


exon

Literature and cross-references LuPrx138(Lus10025737|PACid:23177517)
DNA ref. Phytozome 12:   scaffold605 (194675..193920)
Protein sequence: LuPrx138(Lus10025737|PACid:23177517)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   186
PWM (Da):   %s   20389.05  
PI (pH):   %s   4.7
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASRDAVSLTGGPQWEVKLGRLDSLTASQADADAIMPSPRANATMLIDLFERFNLSLYNQSGSGRPDPAIEPGYRQKLMELCPMGGDENVTVGLDSTPLVFDNVYFKDLVGGRGFLNSDETLFTYPITRKYVQEFGRDQDAFFEAFAEGMIKMGDLQSGLPGEVRRNCRVANGGRRQVSNRLSSFS*

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction. 5' end is missing. Gap in fram.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCCGTGACGCTGTTTCCCTCGTAAATTCAACCTTCCTCTGTTTCTTCTTTTCCTTAATTACTCTGTTTATAATTGGAGGGGTGGTGATTTCTTCTTTCTGTTGCAGACGGGTG
GGCCCCAGTGGGAAGTGAAGCTGGGGAGGCTGGACAGTCTGACGGCGAGCCAGGCCGACGCCGACGCAATCATGCCAAGCCCGAGAGCCAACGCCACGATGCTGATCGACCTCTTCGAGA
GATTCAACCTCTCG
GTAAAAGACATGGTTGCCCTCTCTGGCTCCCACTCCATAGGGAAAGGACGCTGCTTCTCCATCCAGTTCCGCCTCTACAACCCGCCGCTCCTCCTCCACCAATCTC
CACCTCTACAACCAGTCCGGGTCGGGCCGACCCGACCCTGCGATTGAGCCAGGGTACAGGCAGAAGCTGATGGAGCTTTGTCCGATGGGGGGAGACGAGAACGTGACGGTGGGTTTGGAT
TCGACTCCGCTTGTGTTCGACAACGTGTATTTCAAGGATTTGGTGGGCGGGAGAGGGTTCTTGAACTCCGACGAAACGCTCTTCACTTATCCAATCACCAGGAAGTACGTGCAGGAGTTC
GGCCGGGATCAGGATGCGTTTTTTGAGGCGTTTGCGGAAGGGATGATTAAGATGGGTGACTTGCAGTCTGGGCTGCCAGGTGAAGTCAGGAGGAACTGCCGGGTTGCTAATGGCGGCCGG
CGGCAGGTCAGCAATCGATTGAGCAGCTTCAGTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCCGTGACGCTGTTTCCCTCACGGGTGGGCCCCAGTGGGAAGTGAAGCTGGGGAGGCTGGACAGTCTGACGGCGAGCCAGGCCGACGCCGACGCAATCATGCCAAGCCCGAGA
GCCAACGCCACGATGCTGATCGACCTCTTCGAGAGATTCAACCTCTCG
CTCTACAACCAGTCCGGGTCGGGCCGACCCGACCCTGCGATTGAGCCAGGGTACAGGCAGAAGCTGATGGAG
CTTTGTCCGATGGGGGGAGACGAGAACGTGACGGTGGGTTTGGATTCGACTCCGCTTGTGTTCGACAACGTGTATTTCAAGGATTTGGTGGGCGGGAGAGGGTTCTTGAACTCCGACGAA
ACGCTCTTCACTTATCCAATCACCAGGAAGTACGTGCAGGAGTTCGGCCGGGATCAGGATGCGTTTTTTGAGGCGTTTGCGGAAGGGATGATTAAGATGGGTGACTTGCAGTCTGGGCTG
CCAGGTGAAGTCAGGAGGAACTGCCGGGTTGCTAATGGCGGCCGGCGGCAGGTCAGCAATCGATTGAGCAGCTTCAGTTAA

Retrieve as FASTA