Entry information : LuPrx144(Lus10027163|PACid:23145585)
Entry ID 12092
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx144(Lus10027163|PACid:23145585)
Name LuPrx144(Lus10027163|PACid:23145585)
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx144
start..stop
S start..stop
LuPrx204 652 0 1..328 1..328
PtPrx25 514 0 18..328 15..324
MePrx24 502 0 6..328 4..325
PtrtrPrx05 500 2e-180 12..328 8..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 65901..66119 219 N° 2 65527..65718 192 N° 3 65284..65446 163 N° 4 64448..64860 413
complement(join(64448..64860,65284..65446,65527..65718,65901..66119))


exon

Literature and cross-references LuPrx144(Lus10027163|PACid:23145585)
DNA ref. Phytozome 12:   scaffold472 (66119..64448)
Protein sequence: LuPrx144(Lus10027163|PACid:23145585)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (302)
PWM (Da):   %s   35780.3 (33009.8) Transmb domain:   %s   i7-26o
PI (pH):   %s   8.57 (8.21) Peptide Signal:   %s   cut: 27 range:27-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARLRFSSIALLVMVVALVSVGSANAQLKMGFYSKSCPKAENIIQDFIHQHITSVPSLAATFIRMHFHDCFVRGCDASVLLNTTSGEQLEKQAPPNLTLRGFDFIDRVKSLVEAECPGVVSCADVLTLVTRDSIVAVGGPSWRVPTGRRDGVISRFSESLNNIPPPFANFTTLQTMFANQGLDVKDLVLLSGAHTIGISHCSSFSNRLYNFTGRGDADPALDTSYASNLRSRKCRSISDSTTKVEMDPGSRNTFDLSYYSLLLKRRGLFESDAALITNSASLQLVEKIAKGSVKDFFDEFALAMEKLGRVNVKTGSNGEIRKQCALVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGGCTGAGATTTTCTTCTATTGCATTACTTGTAATGGTGGTAGCTCTTGTTTCGGTCGGATCGGCAAATGCTCAGTTGAAGATGGGCTTCTACTCCAAGAGCTGTCCCAAAGCG
GAGAATATCATACAAGACTTCATCCACCAGCACATCACCAGTGTGCCTTCTCTTGCCGCCACATTCATCAGGATGCATTTCCACGATTGCTTCGTCAGG
GTTCGTTTCCACCTCTCAAAA
TATAATCTTCTTAGTACCACATTGGTTGAATAAGGCTATCTTTATGTTGTTGAGATTGGTGTGTGAATGAGCATGATGAGATGGTTTGAACCGATGATTCTGACCGAATCGGTCCATATC
TGACCGATTTTGGTTCTGACTATGTTTGTTGTGTGTTCTAGGGATGTGATGCATCGGTGCTCCTGAACACAACCTCAGGGGAGCAACTCGAGAAGCAGGCGCCTCCTAACCTGACACTCA
GAGGGTTCGACTTCATTGACAGGGTGAAGAGCCTCGTTGAAGCTGAATGCCCTGGAGTTGTTTCCTGTGCTGATGTCCTGACTCTGGTCACTAGGGACTCAATCGTTGCAGTT
GTACGTA
GTATGTCGCTTAACTTTGTAATCATGTGTGAAGTTTTTCAGGTTCTGATGATTTGTGGTGTTGTTTTCGACAGGGCGGTCCATCTTGGAGAGTTCCCACGGGGCGAAGAGACGGTGTGAT
CTCTCGATTTTCGGAGTCTCTGAACAACATTCCTCCTCCATTTGCCAACTTCACCACTCTCCAGACAATGTTTGCCAACCAAGGGCTTGATGTGAAAGACCTTGTGTTGCTTTCAG
GTAA
ATTCTCAAAATGTTTTCGTTTCGGTTTGGTCATGGTTTGACCGGACTAGATTCAGTCGATCGCCGGAATTGTGACCGATTTCAGCTTGCTGTGACCAAAATCAACTCGGTCAACCGAAAT
GTGGCATATTGGAGTTGTTTCGGCCGGGTTTAATCTGATAATTGAAATGAAATTCAATTTTGACTGAATTTTAGAAAATGTTCTAGACAATATTAAGCAGCCTATGGACACTAAAAGGTT
TAGACACATGGGGTTGGGACCATGAAATATACAGAAAATTGTACATGATTGAAACCCGTAACCACAGTCAATCTCGAATTGACTGAAAGCAGTTTCGATCAAATTTCGGTTCGATTTCTG
AGTCCAACATGTAACATGTTACTTATAATTCATTTTCTTGCCTTTTTTTGCTTTCTCAGGGGCACATACAATTGGCATTTCACATTGCTCTTCATTCTCCAACCGGCTCTACAACTTCAC
CGGCAGGGGAGACGCCGACCCGGCTCTCGACACCAGCTACGCCTCGAATCTACGATCGAGAAAGTGTCGAAGCATTAGTGACAGCACAACGAAGGTCGAGATGGATCCCGGTAGCAGGAA
CACCTTTGACCTGAGCTACTACTCATTGCTCCTGAAGAGGAGAGGACTGTTCGAGTCGGATGCTGCCCTGATAACCAACTCTGCCTCGTTGCAACTCGTCGAGAAGATCGCAAAAGGCTC
CGTGAAGGATTTCTTCGACGAGTTCGCCCTAGCCATGGAGAAGCTGGGTCGGGTCAATGTGAAAACCGGGTCCAACGGTGAGATCAGGAAGCAATGTGCTTTGGTTAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGGCTGAGATTTTCTTCTATTGCATTACTTGTAATGGTGGTAGCTCTTGTTTCGGTCGGATCGGCAAATGCTCAGTTGAAGATGGGCTTCTACTCCAAGAGCTGTCCCAAAGCG
GAGAATATCATACAAGACTTCATCCACCAGCACATCACCAGTGTGCCTTCTCTTGCCGCCACATTCATCAGGATGCATTTCCACGATTGCTTCGTCAGG
GGATGTGATGCATCGGTGCTC
CTGAACACAACCTCAGGGGAGCAACTCGAGAAGCAGGCGCCTCCTAACCTGACACTCAGAGGGTTCGACTTCATTGACAGGGTGAAGAGCCTCGTTGAAGCTGAATGCCCTGGAGTTGTT
TCCTGTGCTGATGTCCTGACTCTGGTCACTAGGGACTCAATCGTTGCAGTT
GGCGGTCCATCTTGGAGAGTTCCCACGGGGCGAAGAGACGGTGTGATCTCTCGATTTTCGGAGTCTCTG
AACAACATTCCTCCTCCATTTGCCAACTTCACCACTCTCCAGACAATGTTTGCCAACCAAGGGCTTGATGTGAAAGACCTTGTGTTGCTTTCAG
GGGCACATACAATTGGCATTTCACAT
TGCTCTTCATTCTCCAACCGGCTCTACAACTTCACCGGCAGGGGAGACGCCGACCCGGCTCTCGACACCAGCTACGCCTCGAATCTACGATCGAGAAAGTGTCGAAGCATTAGTGACAGC
ACAACGAAGGTCGAGATGGATCCCGGTAGCAGGAACACCTTTGACCTGAGCTACTACTCATTGCTCCTGAAGAGGAGAGGACTGTTCGAGTCGGATGCTGCCCTGATAACCAACTCTGCC
TCGTTGCAACTCGTCGAGAAGATCGCAAAAGGCTCCGTGAAGGATTTCTTCGACGAGTTCGCCCTAGCCATGGAGAAGCTGGGTCGGGTCAATGTGAAAACCGGGTCCAACGGTGAGATC
AGGAAGCAATGTGCTTTGGTTAATTAG

Retrieve as FASTA