Entry information : LuPrx146(Lus10027405|PACid:23144459)
Entry ID 12094
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx146(Lus10027405|PACid:23144459)
Name LuPrx146(Lus10027405|PACid:23144459)
Class Class III peroxidase    [Orthogroup: Prx036]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx146
start..stop
S start..stop
LuPrx175 615 0 1..321 1..321
RcPrx67 488 1e-175 9..321 11..323
MePrx90 487 3e-175 9..321 11..323
EgrPrx56 484 5e-174 14..321 16..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 140584..140796 213 N° 2 140305..140493 189 N° 3 139496..140059 564  
complement(join(139496..140059,140305..140493,140584..140796))


exon

Literature and cross-references LuPrx146(Lus10027405|PACid:23144459)
DNA ref. Phytozome 11:   scaffold96 (140796..139496)
Protein sequence: LuPrx146(Lus10027405|PACid:23144459)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (297)
PWM (Da):   %s   34844.51 (32255.1)  
PI (pH):   %s   8.32 (7.99) Peptide Signal:   %s   cut: 25 range:25-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAALRVGCFATTLLLITLISSSRGTLDAHYYDQTCPQAEAIVSQSVRNASIYDPKVPARILRMFFHDCFIRGCDASILIDSTPGNQAEKDGPPNVSVRSFYVIDDAKTKLEKACPETVSCADIIAIAARDVVAMSEGPSWNVQKGRKDGSISKSSDTVNLPAPTFNVTQLSQAFASRGLAIKDLVALSGAHTLGFSHCSSFQSRLRKFSSIHYTDPTMNPELANVLMKKCPNPNSNPTTGTFLDSTSSKFDNEYFKQLVEGKGVFGSDQSLFIDGRTKGIVKGFAKDEGMFFREFASSMVKLGSVGVLENGEVRKQCRVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTCTCCGAGTTGGATGCTTTGCAACGACCCTTCTCTTGATCACACTGATCTCGTCATCACGAGGAACGTTGGATGCCCATTATTATGATCAAACATGTCCGCAGGCTGAGGCC
ATTGTCTCTCAGTCGGTTCGCAATGCCTCGATCTACGACCCCAAAGTCCCTGCTCGCATCCTTAGAATGTTCTTCCATGACTGTTTCATTAGG
GTACGTAAGTCGCAATGTTTATACTAT
ATAATTTTGGGGTGGGATTGGTTAATTATGGTACTTAACTGTTTTTTATGATTAAAAAAACAGGGCTGTGATGCTTCTATTTTGATTGACTCTACTCCTGGAAACCAAGCTGAGAAAGAT
GGACCTCCGAATGTTTCGGTTCGATCGTTCTATGTGATCGACGATGCCAAAACCAAGCTCGAAAAGGCTTGTCCCGAAACGGTGTCGTGTGCTGATATCATAGCTATAGCAGCTAGAGAT
GTTGTAGCCATG
GTAAGTTATTATATACCTTTAATGTTATATAAAATTAAATATAAACCTCTCCCAATCATTCTAGTTATTAAAGTTGAATTTTATTAGCCTCAATATAACCATTTTACC
GATATAAAATTTAGTGGACATATACAAACTTTAATCTCTATTTCTCAATTCATGAACTTTTGTTTGATTGGGCAAAATGCATATTTATTATTTAATTAAACGAAGAGTTTGACTAAGCCC
ACATTTTAATTTTTCAGTCAGAAGGGCCAAGTTGGAACGTACAAAAAGGCAGAAAAGACGGCAGTATCTCAAAATCAAGCGACACCGTGAACTTGCCAGCTCCAACATTCAACGTGACAC
AACTAAGCCAAGCCTTTGCGAGTCGAGGCTTAGCCATCAAGGACTTAGTAGCCCTGTCTGGAGCCCACACATTAGGGTTCTCACACTGTTCTTCGTTCCAATCTCGCCTCCGAAAGTTCA
GCTCCATCCACTACACCGATCCAACCATGAACCCGGAACTCGCCAACGTGTTGATGAAGAAGTGCCCTAACCCGAACTCCAATCCTACTACAGGGACATTCCTCGATTCGACCTCTTCAA
AGTTCGACAATGAGTACTTCAAACAGCTCGTGGAAGGGAAAGGGGTATTTGGATCAGACCAGTCGTTGTTTATTGATGGGAGGACAAAGGGGATCGTTAAAGGGTTTGCCAAGGATGAGG
GGATGTTCTTCAGGGAATTTGCTTCTTCGATGGTGAAGCTTGGGAGTGTTGGTGTTCTTGAGAATGGTGAAGTGAGGAAGCAATGTAGGGTTGTGAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTCTCCGAGTTGGATGCTTTGCAACGACCCTTCTCTTGATCACACTGATCTCGTCATCACGAGGAACGTTGGATGCCCATTATTATGATCAAACATGTCCGCAGGCTGAGGCC
ATTGTCTCTCAGTCGGTTCGCAATGCCTCGATCTACGACCCCAAAGTCCCTGCTCGCATCCTTAGAATGTTCTTCCATGACTGTTTCATTAGG
GGCTGTGATGCTTCTATTTTGATTGAC
TCTACTCCTGGAAACCAAGCTGAGAAAGATGGACCTCCGAATGTTTCGGTTCGATCGTTCTATGTGATCGACGATGCCAAAACCAAGCTCGAAAAGGCTTGTCCCGAAACGGTGTCGTGT
GCTGATATCATAGCTATAGCAGCTAGAGATGTTGTAGCCATG
TCAGAAGGGCCAAGTTGGAACGTACAAAAAGGCAGAAAAGACGGCAGTATCTCAAAATCAAGCGACACCGTGAACTTG
CCAGCTCCAACATTCAACGTGACACAACTAAGCCAAGCCTTTGCGAGTCGAGGCTTAGCCATCAAGGACTTAGTAGCCCTGTCTGGAGCCCACACATTAGGGTTCTCACACTGTTCTTCG
TTCCAATCTCGCCTCCGAAAGTTCAGCTCCATCCACTACACCGATCCAACCATGAACCCGGAACTCGCCAACGTGTTGATGAAGAAGTGCCCTAACCCGAACTCCAATCCTACTACAGGG
ACATTCCTCGATTCGACCTCTTCAAAGTTCGACAATGAGTACTTCAAACAGCTCGTGGAAGGGAAAGGGGTATTTGGATCAGACCAGTCGTTGTTTATTGATGGGAGGACAAAGGGGATC
GTTAAAGGGTTTGCCAAGGATGAGGGGATGTTCTTCAGGGAATTTGCTTCTTCGATGGTGAAGCTTGGGAGTGTTGGTGTTCTTGAGAATGGTGAAGTGAGGAAGCAATGTAGGGTTGTG
AATTGA

Retrieve as FASTA