Entry information : LuPrx15 (Lus10001622|PACid:23145987)
Entry ID 12097
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx15 (Lus10001622|PACid:23145987)
Name (synonym) LuPrx15 (Lus10001622|PACid:23145987)
Class Class III peroxidase     [Orthogroup: Prx020]*
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx15
start..stop
S start..stop
LuPrx14 409 3e-144 89..329 71..325
MePrx133 366 1e-127 89..329 63..317
MePrx03 363 7e-126 88..329 66..321
RcPrx06 361 2e-125 89..329 68..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2541..2822 282 N° 2 3415..3612 198 N° 3 3814..4199 386 N° 4 4240..4363 124
join(2541..2822,3415..3612,3814..4199,4240..4363)


exon

Literature and cross-references LuPrx15 (Lus10001622|PACid:23145987)
DNA ref. Phytozome 12:   scaffold1136 (2541..4363)
Protein sequence: LuPrx15 (Lus10001622|PACid:23145987)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330
PWM (Da):   %s   36062.33  
PI (pH):   %s   9.35
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPISCLAYQMNPRHQLNNPTNINSQKYHTSNRDPYLNRQQSGTKRSVAAVLFGVLLVLQMATLLGKGNEIGECHPAKTDMEERVDGAGQDVLGVGCDASVLLAPPTNNAEKDHPDDISLAGDGFDTVIKAKVAIDRVPRCRNKVSCTDILALATCEVVSLGGPFYRVELGRRDGRVSTKASVERQLPHANFNLNQLNQMFAARSLSQTDMIALSGAHTLGFSHCNQFSNRIYGFSSRNRIDPTLNFQYALQLRQMCPIRVDPRIAINMDPTSPQRFRQCILRELATGEGSRPTVNRFAASNAAFRQAFAAAVTKLGRVGVLTGSRGEIR*

Retrieve as FASTA  
Remarks Warnings: The paralog 100012070 is in an intron of the proteins.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTATCAGTTGTCTGGCTTATCAAATGAATCCCAGACACCAATTGAACAATCCAACTAACATCAATTCACAAAAGTACCACACTTCGAATAGAGATCCGTACCTGAATCGACAACAA
AGCGGGACGAAGAGATCAGTGGCCGCCGTGCTCTTTGGCGTGCTGCTGGTGCTCCAGATGGCGACGCTCCTCGGGAAGGGCAACGAGATAGGAGAATGCCATCCCGCCAAAACAGACATG
GAGGAGCGGGTCGACGGAGCTGGTCAGGATGTACTTGGCGTG
GTAATTATCCAATCCTTTCTGCACAGATTTCTTCACGAAGTCGAGCGACAGCATCGGCTTCACGTGGTTTGGGAGCTC
CTTCACCTTCAACCCCTTGATCTCGCTGTAGAACCTCCTCATCGCCATTTCTTCTACGAAGCTCCGGATTACGGATCGCTGTGTTTAGCGGACGATTATGAGGAGCCCTAGCACCGGAAT
GAATATTTCAGCTGATTTGGGGGGAAATTCGGGAGCCCCCAATCGCGAGGGACGGGCGCGAGTTTGTAGCGGGAGGGCTTGTAGATATTGGGCCCTTCGGGATCAGCCCAGTTACTTTTC
AAAATCCGATTCTACAAATTTTGAAATCTCTAACTCAGTTTAAGTTGAGTTGATATGTCGGTAAAATTATGTGTTTGAAACGTATGTTGAAAACGGCTAAAAAATCAAGTTTTAACATGT
CAGATTCTCTGATTTTAGCCAAATGAAATCAAAAAGTTATTTTTCGGACGTGTTTTATGAATTTTTCAAATATATATATTAGACATTAGCTATATTGAATTTAACTAATATGTACTATTA
TTAATATGGTTGATGTTGATTATTTTAAACATAGGGATGTGATGCTTCTGTGCTCCTTGCACCCCCCACCAACAATGCGGAGAAGGATCACCCGGACGACATATCGCTAGCCGGCGACGG
ATTTGACACTGTCATCAAGGCCAAGGTGGCCATTGACCGTGTCCCTCGCTGTCGCAACAAGGTCTCTTGCACTGATATCCTTGCTCTCGCCACCTGCGAAGTTGTCTCCCTG
GTACTCCT
CTACCCCGAAACACCTTGTAGTTATGGTTGCATACCACCCAAATAGGTCGGTTTTGGTTAAAATAAGTGTAACAATGAATAGAGTTGGTTGGTTTATCGGATTTGACCAACTGTACGGAA
CAAGCACACATTGATCTGTTCGCAAGCGACTTATCTCGAAACTAAAAACTGATGCTTTATACTTTACAGACAGGGGGGGCCGTTCTACAGAGTGGAGCTAGGTAGAAGAGACGGACGAGT
ATCAACAAAAGCAAGCGTCGAACGCCAACTCCCACACGCAAACTTCAACTTGAATCAGCTCAACCAAATGTTCGCCGCACGTTCACTCTCCCAAACAGACATGATCGCACTCTCCGGAGC
ACACACTTTAGGCTTCTCCCACTGCAACCAATTCTCAAACCGGATATATGGATTCAGCTCGAGAAACCGAATTGACCCGACCCTCAACTTCCAGTATGCACTGCAGCTCAGGCAGATGTG
CCCCATCCGGGTCGACCCGAGGATCGCGATCAACATGGACCCCACGTCTCCTCAGCGGTTTCGACAATGCATACTACGGGAACTTGCAACAGGGGAAGG
GTTTGTTCACTTCTGACCAAG
TGCTTCTTACTGACCCCAGGTCGAGACCGACTGTGAACCGGTTTGCGGCCAGCAATGCTGCTTTCAGGCAGGCGTTTGCTGCCGCTGTCACGAAGTTAGGGCGCGTTGGTGTGCTCACCG
GATCTCGTGGCGAGATCCGGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTATCAGTTGTCTGGCTTATCAAATGAATCCCAGACACCAATTGAACAATCCAACTAACATCAATTCACAAAAGTACCACACTTCGAATAGAGATCCGTACCTGAATCGACAACAA
AGCGGGACGAAGAGATCAGTGGCCGCCGTGCTCTTTGGCGTGCTGCTGGTGCTCCAGATGGCGACGCTCCTCGGGAAGGGCAACGAGATAGGAGAATGCCATCCCGCCAAAACAGACATG
GAGGAGCGGGTCGACGGAGCTGGTCAGGATGTACTTGGCGTG
GGATGTGATGCTTCTGTGCTCCTTGCACCCCCCACCAACAATGCGGAGAAGGATCACCCGGACGACATATCGCTAGCC
GGCGACGGATTTGACACTGTCATCAAGGCCAAGGTGGCCATTGACCGTGTCCCTCGCTGTCGCAACAAGGTCTCTTGCACTGATATCCTTGCTCTCGCCACCTGCGAAGTTGTCTCCCTG
GGGGGGCCGTTCTACAGAGTGGAGCTAGGTAGAAGAGACGGACGAGTATCAACAAAAGCAAGCGTCGAACGCCAACTCCCACACGCAAACTTCAACTTGAATCAGCTCAACCAAATGTTC
GCCGCACGTTCACTCTCCCAAACAGACATGATCGCACTCTCCGGAGCACACACTTTAGGCTTCTCCCACTGCAACCAATTCTCAAACCGGATATATGGATTCAGCTCGAGAAACCGAATT
GACCCGACCCTCAACTTCCAGTATGCACTGCAGCTCAGGCAGATGTGCCCCATCCGGGTCGACCCGAGGATCGCGATCAACATGGACCCCACGTCTCCTCAGCGGTTTCGACAATGCATA
CTACGGGAACTTGCAACAGGGGAAGG
GTCGAGACCGACTGTGAACCGGTTTGCGGCCAGCAATGCTGCTTTCAGGCAGGCGTTTGCTGCCGCTGTCACGAAGTTAGGGCGCGTTGGTGTG
CTCACCGGATCTCGTGGCGAGATCCGGTGA

Retrieve as FASTA