Entry information : LuPrx156 (Lus10028689|PACid:23164596)
Entry ID 12103
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2014-03-18 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2014-03-19 (Christophe Dunand)
Peroxidase information: LuPrx156 (Lus10028689|PACid:23164596)
Name (synonym) LuPrx156 (Lus10028689|PACid:23164596)
Class Class III peroxidase     [Orthogroup: Prx007]*
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx156
start..stop
S start..stop
LuPrx03 685 0 1..357 1..357
PtPrx67 494 4e-177 2..356 5..353
BvPrx25 493 1e-176 5..348 2..343
NtPrx15 487 3e-174 5..335 7..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 847539..847818 280 N° 2 848393..848616 224 N° 3 848741..849166 426  
join(847539..847818,848393..848616,848741..849166)


exon

Literature and cross-references LuPrx156 (Lus10028689|PACid:23164596)
Literature Day A, Fénart S, Neutelings G, Hawkins S, Rolando C, Tokarski C. Identification of cell wall proteins in the flax (Linum usitatissimum) stem. Proteomics. 2013 13(5):812-25.
DNA ref. Phytozome 12:   scaffold346 (847539..849166)
Protein sequence: LuPrx156 (Lus10028689|PACid:23164596)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   357 (331)
PWM (Da):   %s   38205.36 (35473.9) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.77 (6.66) Peptide Signal:   %s   cut: 27 range:27-357
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSSHVVALTIVLSAVLFASMTTAQIPAPAKGMSWTFYKSSCPKLESIITTRLKEVFKKDIGQAAGLLRLHFHDCFVEGCDGSVLLTGSAGGPSAEQGSPPNLSLRKEAFRIIDDLRARVHKECGRVVSCSDIVAIAARDSVVLSGGPNYQVALGRRDGTALVTQDTTLANLPPPFATTGTILSSLATKNLNPTDAVALSGAHTIGISHCSSFTDRLYPNQDPSMDQTFAKTLKATCPQAATTDNIVNQDIRSPNVFDNKYYVDLMNRQGLFTSDQDLYTDSRTRGIVTSFAVNQTLFFEKFVVAMIKMGQISVLTGTQGEIRANCSLTNSAKVGTSSFLEEAVEEAVELLAGMR*

Retrieve as FASTA  
Remarks Pseudogene sequence from genomic. Experimental evidency of cell wall localization. Incorrect prediction from Phytozome : GCDGS is missing due to frame shift, longer 3' end with extra exon due to frame shift and extra seq between SDQ and DLYTDSR .
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCTCTTCTTCCCATGTCGTCGCTCTAACGATCGTGTTGTCGGCGGTGTTGTTCGCATCCATGACGACGGCGCAGATTCCGGCGCCGGCCAAAGGAATGTCGTGGACTTTCTAC
AAGTCCTCCTGCCCCAAGCTCGAGTCCATCATCACTACGCGTCTCAAGGAAGTGTTCAAGAAAGACATTGGCCAGGCCGCAGGCTTGCTCCGCCTCCACTTCCACGACTGCTTCGTCGAG
GTACACACAAAATTTCGTCACTTTAAAATCAAGAAATCAC
GTGATCATCTAAGTTCGTCCACATTCAAATCCGCCATTCGTGTTGACTAGGAGCCATGATTACTCATAATGACTAGCTTC
TAGTGTAGATGGATTTTTAATTTTAATTGGGTTGTTGAAAATTCATAAATATAAATATAAAACTCTTTTTCGTTTCTTCTCCGTATAATTATTAAATGTGGGGTTGTTGTAGTACTATTA
CTCGTATTATTGATATATTATTCAAATGTGACATATCGAGAATTTAGTGGAATGAATGATTAGGATTCTTTAATTCGATTTTTTTAATCAAGCTGATAAATTAGATGATATGACGGATAT
CGGATGTATCGAATTTGAATAGTTCTTTTCGTGAATTGGTTGATACTCGTGGGGATGTGTTCCGTTATTCGTGTTCGGAGCATTGAAATTAGTTAATTATTTGATGTGGGAGCATCAATA
ATACATATATAGTTCCATACAACCACTAAGTTATGGAGAAAAAAATTCCAAAGATGGTGAAGGAAATCTGTCTAGAAATTTTGATGTATGGGAAATGAAAACAATTTTATTTTATTTATT
ATTATTATTTGTAGGGGTGCGATGGATCGGTATTGCTGACTGGATCGGCAGGTGGGGCCCCCCGCGGGGATCGGCAGGTGGGCCCAGCGCGGAGCAAGGGTCCCCACCTAACTTGAGCCT
GAGGAAAGAAGCCTTCCGAATCATCGACGACCTCCGTGCACGTGTCCACAAGGAGTGCGGCCGCGTCGTTTCTTGCTCCGACATTGTCGCTATAGCTGCCCGTGACTCCGTCGTCCTG
GT
ATACATTCAAATCTATTTCGACGAATAAATCGATTCAATTTGACTCGAAGCCAGACCGGTTATTTCGAATTGATCATTTTTCAATCCGATTTCAATTCTAATGTGTATTTTTTCTGCCAT
AGTCTGGTGGGCCAAACTACCAAGTGGCGTTGGGCCGCCGCGACGGTACAGCGCTAGTAACACAAGACACCACCTTGGCCAATCTCCCGCCACCGTTTGCAACCACGGGAACCATCCTCA
GCTCCCTCGCTACCAAGAACCTCAACCCGACCGATGCGGTCGCACTCTCAGGTGCCCACACCATCGGCATTAGCCACTGTTCCTCCTTCACCGACCGCCTCTACCCTAACCAGGACCCCT
CCATGGACCAGACCTTCGCCAAAACCCTCAAGGCCACGTGTCCTCAGGCTGCAACGACCGACAACATCGTCAACCAGGACATCCGGTCGCCGAATGTGTTCGACAACAAGTACTATGTTG
ACTTGATGAACCGACAGGGTCTGTTCACCTCCGATCAGGTACATTTTGGTTCGAGTTCGGATATATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCTCTTCTTCCCATGTCGTCGCTCTAACGATCGTGTTGTCGGCGGTGTTGTTCGCATCCATGACGACGGCGCAGATTCCGGCGCCGGCCAAAGGAATGTCGTGGACTTTCTAC
AAGTCCTCCTGCCCCAAGCTCGAGTCCATCATCACTACGCGTCTCAAGGAAGTGTTCAAGAAAGACATTGGCCAGGCCGCAGGCTTGCTCCGCCTCCACTTCCACGACTGCTTCGTCGAG
GTACACACAAAATTTCGTCACTTTAAAATCAAGAAATCAC
GGGTGCGATGGATCGGTATTGCTGACTGGATCGGCAGGTGGGGCCCCCCGCGGGGATCGGCAGGTGGGCCCAGCGCGGAG
CAAGGGTCCCCACCTAACTTGAGCCTGAGGAAAGAAGCCTTCCGAATCATCGACGACCTCCGTGCACGTGTCCACAAGGAGTGCGGCCGCGTCGTTTCTTGCTCCGACATTGTCGCTATA
GCTGCCCGTGACTCCGTCGTCCTG
TCTGGTGGGCCAAACTACCAAGTGGCGTTGGGCCGCCGCGACGGTACAGCGCTAGTAACACAAGACACCACCTTGGCCAATCTCCCGCCACCGTTT
GCAACCACGGGAACCATCCTCAGCTCCCTCGCTACCAAGAACCTCAACCCGACCGATGCGGTCGCACTCTCAGGTGCCCACACCATCGGCATTAGCCACTGTTCCTCCTTCACCGACCGC
CTCTACCCTAACCAGGACCCCTCCATGGACCAGACCTTCGCCAAAACCCTCAAGGCCACGTGTCCTCAGGCTGCAACGACCGACAACATCGTCAACCAGGACATCCGGTCGCCGAATGTG
TTCGACAACAAGTACTATGTTGACTTGATGAACCGACAGGGTCTGTTCACCTCCGATCAGGTACATTTTGGTTCGAGTTCGGATATATGA

Retrieve as FASTA