Entry information : LuPrx175(Lus10031664|PACid:23180802)
Entry ID 12116
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx175(Lus10031664|PACid:23180802)
Name LuPrx175(Lus10031664|PACid:23180802)
Class Class III peroxidase    [Orthogroup: Prx036]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx175
start..stop
S start..stop
LuPrx146 632 0 1..321 1..321
RcPrx67 493 6e-178 11..321 13..323
MePrx90 493 1e-177 7..321 8..323
PpePrx62 489 3e-176 1..321 3..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 66335..66547 213 N° 2 66655..66843 189 N° 3 67105..67668 564  
join(66335..66547,66655..66843,67105..67668)


exon

Literature and cross-references LuPrx175(Lus10031664|PACid:23180802)
DNA ref. Phytozome 12:   scaffold783 (66335..67668)
Protein sequence: LuPrx175(Lus10031664|PACid:23180802)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (297)
PWM (Da):   %s   34895.61 (32236.1)  
PI (pH):   %s   8.14 (7.72) Peptide Signal:   %s   cut: 25 range:25-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAALRVVCFLTTLLLVTLISSSRGALDAHYYDQTCPQAEAIVSQTVRNASIYDPKVPARILRMFFHDCFIRGCDASILIDSTPGNQAEKDGPPNVSVRSFYVIDDAKAKLEKACPETVSCADIIAIAARDVVAMFGGPNWNVQKGRKDGRISKSSDTVNLPAPTFNVTQLSQAFVSRGLAIKDLVALSGAHTLGFSHCSSFQSRLRKFSSIHYTDPTMNPELANVLMKKCPNPNSDPSAGTFLDSTSSKFDNEYFKQLVEGKGVFGSDQSLFVDGRTKGIVEGFAKDEGMFFREFAASMVKLGSVGVLETGEVRKQCRVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTCTTCGAGTTGTGTGCTTTTTAACGACCCTTCTCTTGGTCACACTGATCTCGTCGTCACGAGGAGCGTTGGATGCCCATTATTACGACCAAACATGTCCGCAGGCTGAGGCC
ATTGTCTCGCAAACGGTTCGCAATGCCTCGATCTACGACCCCAAAGTCCCAGCTCGCATCCTTAGAATGTTCTTCCATGACTGTTTCATAAGG
GTGTGTAAGTCCTAACGTGCTACAAAT
TGTGTTTACTATATAGCTTTTGGGTGTGGGATTGATTAATTATGGTACTTATAACTGTTTTTTATGATTAAAAAAAACAGGGCTGTGATGCTTCTATTTTGATTGACTCTACTCCTGGAA
ACCAAGCTGAGAAAGATGGACCTCCTAATGTTTCGGTTCGATCGTTTTATGTGATCGATGATGCCAAAGCTAAGCTCGAAAAGGCTTGTCCCGAAACGGTGTCGTGTGCTGATATCATAG
CTATAGCGGCTAGAGATGTTGTAGCCATG
GTAAGTTATTATATACTTTTAATGTTGTATAAAATTAATTATAAATATCTTCCAATCATTTTAGTTATTGAAGTTGAATTTTATCAGCCTC
AATATAACCATTTTATTGATATAAAATTTAGTGGACATATGAAAACTTTAATTTTTATTTTTCTATTCATAAACTTTCGTTTGATTAAGCAAAATGCATACTTATTATTTAATTCAAGTT
TACGATTCTGATAATTAAAGTCTGATTAAGCCTATATTTCAAATATTCAGTTTGGAGGACCAAACTGGAACGTACAAAAAGGCAGAAAAGACGGCAGAATCTCAAAATCAAGTGATACAG
TGAACTTACCCGCTCCAACATTCAACGTGACACAATTGAGCCAAGCCTTCGTGAGCCGGGGCCTAGCCATCAAGGACCTAGTAGCACTATCCGGAGCCCACACATTAGGGTTCTCACATT
GCTCTTCATTCCAATCTCGCCTTCGAAAGTTCAGCTCCATCCACTACACCGATCCAACCATGAACCCGGAACTCGCCAACGTGTTGATGAAGAAGTGCCCCAACCCAAACTCTGATCCTT
CTGCAGGGACATTCCTTGATTCGACCTCTTCAAAGTTCGACAACGAGTACTTCAAACAGCTCGTGGAAGGGAAAGGGGTGTTTGGATCAGACCAGTCGTTGTTTGTTGATGGGAGGACAA
AGGGTATCGTTGAAGGGTTTGCCAAGGATGAGGGGATGTTCTTTAGGGAATTTGCTGCTTCCATGGTGAAGCTTGGGAGTGTTGGTGTTCTTGAGACTGGTGAAGTGAGGAAACAATGTA
GGGTTGTGAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTCTTCGAGTTGTGTGCTTTTTAACGACCCTTCTCTTGGTCACACTGATCTCGTCGTCACGAGGAGCGTTGGATGCCCATTATTACGACCAAACATGTCCGCAGGCTGAGGCC
ATTGTCTCGCAAACGGTTCGCAATGCCTCGATCTACGACCCCAAAGTCCCAGCTCGCATCCTTAGAATGTTCTTCCATGACTGTTTCATAAGG
GGCTGTGATGCTTCTATTTTGATTGAC
TCTACTCCTGGAAACCAAGCTGAGAAAGATGGACCTCCTAATGTTTCGGTTCGATCGTTTTATGTGATCGATGATGCCAAAGCTAAGCTCGAAAAGGCTTGTCCCGAAACGGTGTCGTGT
GCTGATATCATAGCTATAGCGGCTAGAGATGTTGTAGCCATG
TTTGGAGGACCAAACTGGAACGTACAAAAAGGCAGAAAAGACGGCAGAATCTCAAAATCAAGTGATACAGTGAACTTA
CCCGCTCCAACATTCAACGTGACACAATTGAGCCAAGCCTTCGTGAGCCGGGGCCTAGCCATCAAGGACCTAGTAGCACTATCCGGAGCCCACACATTAGGGTTCTCACATTGCTCTTCA
TTCCAATCTCGCCTTCGAAAGTTCAGCTCCATCCACTACACCGATCCAACCATGAACCCGGAACTCGCCAACGTGTTGATGAAGAAGTGCCCCAACCCAAACTCTGATCCTTCTGCAGGG
ACATTCCTTGATTCGACCTCTTCAAAGTTCGACAACGAGTACTTCAAACAGCTCGTGGAAGGGAAAGGGGTGTTTGGATCAGACCAGTCGTTGTTTGTTGATGGGAGGACAAAGGGTATC
GTTGAAGGGTTTGCCAAGGATGAGGGGATGTTCTTTAGGGAATTTGCTGCTTCCATGGTGAAGCTTGGGAGTGTTGGTGTTCTTGAGACTGGTGAAGTGAGGAAACAATGTAGGGTTGTG
AATTGA

Retrieve as FASTA