Entry information : LuPrx176(Lus10032035|PACid:23161066)
Entry ID 12117
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx176(Lus10032035|PACid:23161066)
Name LuPrx176(Lus10032035|PACid:23161066)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx176
start..stop
S start..stop
LuPrx191 619 0 1..327 1..328
LuPrx72 495 3e-178 7..326 15..334
MePrx64 477 3e-171 11..327 9..324
PtPrx82 469 3e-168 11..327 6..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 619270..619497 228 N° 2 617636..617827 192 N° 3 616106..616669 564  
complement(join(616106..616669,617636..617827,619270..619497))


exon

Literature and cross-references LuPrx176(Lus10032035|PACid:23161066)
DNA ref. Phytozome 11:   scaffold42 (619497..616106)
Protein sequence: LuPrx176(Lus10032035|PACid:23161066)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (299)
PWM (Da):   %s   34319.83 (31589.5) Transmb domain:   %s   i7-29o
PI (pH):   %s   4.94 (4.94) Peptide Signal:   %s   cut: 29 range:29-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGYFSSSTAAMIMIIVAITIAGGGGVSGQGLRENFYAGSCPMVEAVVQQVVAAKAGRQFPTLPATLRLFFHDCFVTGCDASVMVASPNGDAEKDAPDNLSLAGDGFDAVSRAKTAVEAICPGVVSCADIIAIAARDVVALAGGPTFAVELGRRDGMISSASLVAGNLPEPNMTLPELNAIFAKHNLTQFDMIALSGAHTLGFSHCNRFFDRIYSSTVDPSLNSTYAQELMTACPRDVDPSIAIDMDPTTPRAFDNVYYQNLVEGKGMFSSDQVLFTDGRSRATVVDFARSAADFNGGFAAAMRKLGRVGVKTGSQGRIRSDCSNVNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTACTTCAGTTCCTCTACGGCGGCCATGATTATGATCATCGTGGCAATTACCATCGCCGGCGGCGGCGGCGTGTCGGGACAAGGACTGAGGGAGAATTTCTACGCGGGAAGTTGT
CCTATGGTGGAGGCGGTAGTACAGCAAGTGGTGGCGGCCAAAGCCGGCCGGCAGTTTCCCACCCTGCCAGCCACTCTCCGCCTCTTCTTCCACGATTGCTTCGTTACT
GTAAGATCATCT
TCACGATATATATACATGTTCCTTTAATCACGGTCTAATTACAAGATTCATCATAGTTTGATTGAGAGATTGAAGTCTTGTCGCGGCTGGGGGATGCATGCACCGTGCCGCTCCGAGCGC
CGGCGAAGCATATATGGCCGCCGAGGCAAATAGGCATTCGTCATATATACGCGCCTTATTTAAATATATTCAGTGACTAAGTCTAATCTGTCAAATTTAATCAAGTTGGTAAATATGTGA
CGAAATTTACGTTCATTGTATTTTGAAAATTCTTAGGTTTTACATTATCTATTAAAGATATTCAAGGTAGTAGTACCACTATTTACATGTAGCGATCCTGATTTCATGTAAAATCGATAT
AAGGTGAAACATGAAATCGGACAAATTGAGTTCAAAATAGGGGAACGTACAATTCCACACGATTCTATGATTCCAATTTTTATTAGAATTTGTACTGGTTTGATTTTCGAACCAAATCGA
AGAAGTGATATTACTTTTTTAGAAAAGTTTGAAATCCTAATAAATTGAATCTCACACATAGGACGCCTTTTCTAGTTTTCCAATACTTTATACCAAGCCATCCTTTGGAATTTGGTGTGT
CGGATTTTTGTCCGTCAACACCAAATTCACTTCATCTATGATGAAGTATGCACGGCATAAGTTTTTTGTCTTATAACGAGACGACACAAACTTTCACCTTACTTATCTATTCAGTCTAAT
GGTTTCTAAACTATTTTACTATTTTAGACATCAATAATCATAAAATTTTATAATTTTGTGATTCGATTATATAATTATGATTTTTACCTCTCCTTTCGATTTAGAATCCGATTTTGATTA
CTATGCAGACATGGAAGACATTTTTTTCTTTTTTTTACTTTAAAAACAATGATAATATGATTTGATGTTTGGCCTAGTTAGTAAAAATCCATTTAATACTCAGTATAATACATGTATATG
TACTATATCCGTTTAAAACTTCCGTTCTCGTACTATTGTAGAGCTATTTAATTTTTCGACGTATGTTTGATGCTTCACGTACTAAACACGTATGAAAGAGGTATTACACGTTTAATACAC
GTATTCTAAGGAGTTGAATAGATATTTTAATATTTTTTTATTTATATTCACTTTTAAAATTATAAAATTATAAAATTTTATAATTGTTGCCGAACTTTTAAACATATTGATATGCTGGAA
TAACTTACAAAACTCTGAACGTATTAATATCGTACTATACCCGTATCGTAGGTTAGGTGTTGGCGTTGGAACAGTCCACCTAAAACTTGGATTCCTTTGTTATTCCGAGCAGCCACTGGT
TGACATTAACTGAACTGATGATAGAGACAGAGTTAGGAGCTACCTAATCAATATACAACATACGGCTTATAGTAATTTGATAAATTCATTTGGTGTTTCGCTGTTGACAGGGCTGCGATG
CCTCAGTAATGGTGGCATCACCAAACGGAGACGCGGAGAAAGATGCTCCGGACAATCTTTCCCTGGCCGGCGACGGATTCGACGCCGTATCAAGAGCTAAAACAGCTGTAGAAGCTATAT
GCCCTGGAGTCGTTTCTTGTGCAGATATCATCGCCATCGCAGCTCGTGATGTCGTTGCCTTG
GTACTTAATCCTTCCACAGCACTAATCCCTTCACACTGGCTTAGCTTCCTTCAATATT
CTAGGTGCTCACTATCGGAACCGAACCGAGCTTTACTCATCTCGGGTTTGACTCGGTTGGTTTATAGGCGAGCTCGAGTTTGACTCTGCTTCGATTCTAGCCATATAATTGAGTAGGGCC
ATGGCTCAATTAATTTTGTGTGAGCTCGAGCTCACTTCAAAAACATATAGTTTTGGGGTCCGTGATTATGAGATTTTCAAATAACGGTCTTTAATTTATTGGTCACTAAAGGTCACTAAC
CTGCTGATTATTAAATTAGTGACCACTTTGACATATCAATGACCGTTTTACAAAAAAACGATCACTAACCTAATGGTCACTAAAACGGTATTTTTTGTAGTTCAGCTCAGCTTGAGATTG
GCTCATTTGCCAGTTCCAACGAGCTTAGCTTGTTTGCGGCTCTTAATTAACAAATTCAAGCTCAACTCGGTTCGTTTACTAGTGTTAACAAGTTTTTTAAATTTTGAGCTCACCTCGGAT
ATATTAATATTTTTTTTAAAATATTTTAAAATGAACTCGACTTATATAGTGTAATTAAGTAACTAATCATTAAGACAACATCATTTATCATTATATTTTTGTTTTCTAATCAAAATAAAA
ACATCAAATGATCAAAATCTCTAAAACCAACTCGTAAACTACACTAGTTGCTCCAGTTAATAACTGAGCCTCAACTAAACTACTTTACGAGCCAAACACAGCGAGCTTACGAGGTGATTT
GGCTCACGAGCTAGCCAAACTAAGCCAAATGTAACTCAAATTCAATTTGTTTAAAACCGAACCGAATTTAAATTGAGCTTTTTTCAAACTAAATTTTAATCTAAATTTTTTCGAACCAAA
CATACCAGCGGCTTGGTTACTCGACACCTACGTTATAAACTTGATATATTACAATTTCACTTTTACAGGCAGGAGGCCCGACGTTCGCGGTGGAATTAGGGCGGAGGGACGGCATGATAT
CCAGCGCATCCCTCGTCGCCGGAAACTTGCCGGAGCCAAACATGACCTTACCCGAACTCAACGCAATATTCGCCAAACACAACCTCACCCAATTCGACATGATCGCACTTTCGGGAGCTC
ACACGCTCGGCTTCTCCCACTGCAATCGCTTCTTCGATCGCATCTACTCTTCCACAGTCGACCCTTCCCTGAACTCCACCTACGCCCAGGAGCTGATGACGGCATGCCCGAGGGACGTGG
ATCCCAGCATCGCAATCGACATGGATCCGACAACTCCGAGGGCATTCGACAATGTGTATTACCAGAATCTGGTGGAGGGGAAGGGGATGTTTAGTTCCGACCAGGTTCTGTTCACGGACG
GGAGGTCTCGGGCGACGGTGGTGGATTTCGCGAGGAGTGCTGCGGATTTTAACGGTGGGTTTGCGGCGGCGATGAGGAAGCTTGGGAGAGTTGGGGTTAAGACTGGGAGTCAGGGGAGGA
TTCGGAGTGACTGTTCGAATGTGAACTCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTACTTCAGTTCCTCTACGGCGGCCATGATTATGATCATCGTGGCAATTACCATCGCCGGCGGCGGCGGCGTGTCGGGACAAGGACTGAGGGAGAATTTCTACGCGGGAAGTTGT
CCTATGGTGGAGGCGGTAGTACAGCAAGTGGTGGCGGCCAAAGCCGGCCGGCAGTTTCCCACCCTGCCAGCCACTCTCCGCCTCTTCTTCCACGATTGCTTCGTTACT
GGCTGCGATGCC
TCAGTAATGGTGGCATCACCAAACGGAGACGCGGAGAAAGATGCTCCGGACAATCTTTCCCTGGCCGGCGACGGATTCGACGCCGTATCAAGAGCTAAAACAGCTGTAGAAGCTATATGC
CCTGGAGTCGTTTCTTGTGCAGATATCATCGCCATCGCAGCTCGTGATGTCGTTGCCTTG
GCAGGAGGCCCGACGTTCGCGGTGGAATTAGGGCGGAGGGACGGCATGATATCCAGCGCA
TCCCTCGTCGCCGGAAACTTGCCGGAGCCAAACATGACCTTACCCGAACTCAACGCAATATTCGCCAAACACAACCTCACCCAATTCGACATGATCGCACTTTCGGGAGCTCACACGCTC
GGCTTCTCCCACTGCAATCGCTTCTTCGATCGCATCTACTCTTCCACAGTCGACCCTTCCCTGAACTCCACCTACGCCCAGGAGCTGATGACGGCATGCCCGAGGGACGTGGATCCCAGC
ATCGCAATCGACATGGATCCGACAACTCCGAGGGCATTCGACAATGTGTATTACCAGAATCTGGTGGAGGGGAAGGGGATGTTTAGTTCCGACCAGGTTCTGTTCACGGACGGGAGGTCT
CGGGCGACGGTGGTGGATTTCGCGAGGAGTGCTGCGGATTTTAACGGTGGGTTTGCGGCGGCGATGAGGAAGCTTGGGAGAGTTGGGGTTAAGACTGGGAGTCAGGGGAGGATTCGGAGT
GACTGTTCGAATGTGAACTCTTAG

Retrieve as FASTA