Entry information : LuPrx182(Lus10032926|PACid:23160325)
Entry ID 12121
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx182(Lus10032926|PACid:23160325)
Name LuPrx182(Lus10032926|PACid:23160325)
Class Class III peroxidase    [Orthogroup: Prx013]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx182
start..stop
S start..stop
PtPrx90 482 3e-173 8..325 12..330
PnPrx90 481 7e-173 7..325 12..329
EgrPrx43 481 9e-173 1..325 1..322
EcamPrx43 480 1e-172 1..325 1..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 275393..275602 210 N° 2 275687..275878 192 N° 3 275961..276126 166 N° 4 276227..276636 410
join(275393..275602,275687..275878,275961..276126,276227..276636)


exon

Literature and cross-references LuPrx182(Lus10032926|PACid:23160325)
DNA ref. Phytozome 12:   scaffold51 (275393..276636)
Protein sequence: LuPrx182(Lus10032926|PACid:23160325)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (305)
PWM (Da):   %s   34353.97 (31982.8)  
PI (pH):   %s   7.38 (7.29) Peptide Signal:   %s   cut: 21 range:21-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMKLVEGVVIMMMFITVHHGVECQLQVGFYSGSCGLAEFVVKTAVREAFIKDSGVAAGLLRMHFHDCFVRGCDGSVLIDSTTSNTAEKDNPANNPSLRGFQVIDTAKSRLESICKGVVSCADILAFAARDSIELSGGFGYDVPSGRKDGRISSSSEASSNLPPPSANVAQLTQIFANKGLSQAEMVTLSGGHTIGRSHCTSVSPRLYNFNGTGQDPTLDSNYATALKQQCPQGNSNANLVVPMNPRSPAVLDEGYYVDILSNRGLFTSDQTLLTNAVTTAQVSQNAASRALWSAKFSAAMVKMGQIGVSTGSAGEIRANCRVINS*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAAGTTGGTGGAAGGAGTTGTGATAATGATGATGTTCATAACAGTGCATCATGGTGTAGAATGTCAACTTCAAGTTGGATTCTACAGCGGTTCATGTGGGTTAGCTGAGTTCGTT
GTTAAAACTGCTGTAAGAGAAGCTTTCATCAAGGACAGTGGAGTTGCTGCCGGCCTTCTCCGAATGCACTTCCACGACTGCTTCGTCCGA
GTAAGTTAGTTATTGTCTCCCTCGATTTTT
GTGATTTCGGCATGAATATTAATTAACAACAATCTTCACCATGTTTCGGCTCAGGGGTGTGATGGATCGGTGTTGATAGATTCGACCACATCTAACACGGCCGAGAAAGACAACCCCGCC
AACAACCCCAGCCTTCGAGGTTTCCAAGTGATTGATACCGCCAAGTCTAGGCTCGAAAGCATCTGCAAAGGGGTCGTTTCTTGTGCTGACATTCTGGCCTTCGCTGCAAGGGATAGCATC
GAGTTG
GTATGTACAACTGATGTTTTTCTTACTTTCCACCTGCCAAACCAAACATATATCTTCACAGTTTTGTGGATATGAAATACAGAGTGGAGGTTTTGGCTACGACGTCCCTTCAGG
GAGAAAAGACGGCAGAATTTCCTCGTCGTCAGAAGCCTCGTCAAACTTACCTCCTCCATCAGCCAACGTAGCTCAACTCACTCAAATATTCGCCAACAAGGGACTTTCGCAGGCAGAAAT
GGTCACTCTCTCCG
GTAAGTTAGGATACACGATACCGCACCCCTAGTACCGTACCGAAATAAGGTCTCCCTTAGTTTTTGCGAAAAATTAAGCTCTTCAAATTCGTGGTTGCAGGAGGAC
ATACTATAGGCCGTTCGCACTGCACATCTGTGTCGCCTAGGCTCTACAACTTCAACGGAACGGGTCAGGATCCGACTTTGGACTCCAACTATGCCACAGCCTTGAAGCAGCAGTGTCCAC
AGGGGAACTCCAATGCTAACCTTGTGGTGCCGATGAATCCTAGGAGCCCCGCCGTATTGGATGAAGGCTACTACGTGGACATCCTCTCCAACCGCGGCCTCTTCACCTCTGACCAGACCC
TGCTCACAAACGCTGTGACCACAGCCCAGGTTAGCCAGAATGCAGCAAGCCGAGCTCTCTGGAGTGCCAAGTTTTCCGCTGCCATGGTGAAGATGGGTCAGATCGGCGTCTCGACTGGCA
GTGCTGGTGAGATTCGAGCCAACTGCCGGGTAATCAACAGTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGAAGTTGGTGGAAGGAGTTGTGATAATGATGATGTTCATAACAGTGCATCATGGTGTAGAATGTCAACTTCAAGTTGGATTCTACAGCGGTTCATGTGGGTTAGCTGAGTTCGTT
GTTAAAACTGCTGTAAGAGAAGCTTTCATCAAGGACAGTGGAGTTGCTGCCGGCCTTCTCCGAATGCACTTCCACGACTGCTTCGTCCGA
GGGTGTGATGGATCGGTGTTGATAGATTCG
ACCACATCTAACACGGCCGAGAAAGACAACCCCGCCAACAACCCCAGCCTTCGAGGTTTCCAAGTGATTGATACCGCCAAGTCTAGGCTCGAAAGCATCTGCAAAGGGGTCGTTTCTTGT
GCTGACATTCTGGCCTTCGCTGCAAGGGATAGCATCGAGTTG
AGTGGAGGTTTTGGCTACGACGTCCCTTCAGGGAGAAAAGACGGCAGAATTTCCTCGTCGTCAGAAGCCTCGTCAAAC
TTACCTCCTCCATCAGCCAACGTAGCTCAACTCACTCAAATATTCGCCAACAAGGGACTTTCGCAGGCAGAAATGGTCACTCTCTCCG
GAGGACATACTATAGGCCGTTCGCACTGCACA
TCTGTGTCGCCTAGGCTCTACAACTTCAACGGAACGGGTCAGGATCCGACTTTGGACTCCAACTATGCCACAGCCTTGAAGCAGCAGTGTCCACAGGGGAACTCCAATGCTAACCTTGTG
GTGCCGATGAATCCTAGGAGCCCCGCCGTATTGGATGAAGGCTACTACGTGGACATCCTCTCCAACCGCGGCCTCTTCACCTCTGACCAGACCCTGCTCACAAACGCTGTGACCACAGCC
CAGGTTAGCCAGAATGCAGCAAGCCGAGCTCTCTGGAGTGCCAAGTTTTCCGCTGCCATGGTGAAGATGGGTCAGATCGGCGTCTCGACTGGCAGTGCTGGTGAGATTCGAGCCAACTGC
CGGGTAATCAACAGTTAG

Retrieve as FASTA