Entry information : LuPrx191 (Lus10035204|PACid:23162416)
Entry ID 12127
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2015-09-29 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-10-06 (Achraf Jemmat)
Peroxidase information: LuPrx191 (Lus10035204|PACid:23162416)
Name (synonym) LuPrx191 (Lus10035204|PACid:23162416)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type Endoderm
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx191
start..stop
S start..stop
LuPrx176 597 0 1..328 1..327
LuPrx72 483 3e-173 8..327 15..334
MePrx64 474 3e-170 12..328 9..324
RcPrx76 462 1e-165 29..328 26..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1075091..1075321 231 N° 2 1073984..1074175 192 N° 3 1073518..1073904 387  
complement(join(1073518..1073904,1073984..1074175,1075091..1075321))


exon

Literature and cross-references LuPrx191 (Lus10035204|PACid:23162416)
DNA ref. Phytozome 11:   scaffold43 (1075321..1073518)
EST ref. GenBank:   JG044614.1 [3' end]
Protein sequence: LuPrx191 (Lus10035204|PACid:23162416)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (302)
PWM (Da):   %s   34401.01 (31925.8) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.11 (6.11) Peptide Signal:   %s   cut: 30 range:27-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGYFSSSTSAAMIMIIVATTIAGGGGVSGQGLRENFYAGSCPMVEPIVQQVVAAKAGRQFPTLPATLRLFFHDCFVTGCDASVMVASPNGDAEKDALDNLSLAGDGFDAVSRAKTAVEAICPGVVSCADIIAIAARDVVALAGGPTFAVELGRRDGMISSVSLVAGNLPEPNMTLPELNAIFAKHNLTQFDMIALSGVHTLGFSHCNRFFNRIYSSTVDPSLNSTYAQQLMTACPRNVDPSIRNRHGSDDSEGIRQRVLPESGRGEGYV*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST. Incorrect prediction from Phytozome due to frame shift in 3'.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTACTTCAGTTCCTCTACGTCGGCGGCCATGATTATGATCATCGTTGCGACTACCATCGCTGGGGGCGGCGGCGTGTCAGGCCAAGGACTGAGGGAGAATTTCTACGCGGGAAGT
TGTCCAATGGTGGAGCCTATAGTACAGCAAGTGGTGGCGGCCAAAGCCGGCCGGCAGTTCCCCACCCTACCAGCCACTCTCCGCCTCTTCTTCCACGACTGCTTCGTTACT
GTAAGATCA
TCATCACGATATATATACATGTTCCTTTAATCGCGGTCTGATTACAATATTTATCATAGTTTAATTGAGAGATTAAAGTCTTGTCGCGGCTGGGGGATGCATGCACCGTGCCGCTCTGAG
CGCCGGCGAAGCATGACCGACGAGGCAAATAGGATTTCGTCAACGACTGTTAAATATAAGAGTTGGTAAATATGTGATTAAAAATACGTACGTTGTATTTTGAAATTCGTAGATTAACAT
CAAGATAACTTTTTATTTCTTTTGACTTTAAGAAAATGATAAAGGATTTGGTGTTGGTGTTGGCGTTGGAACAGTCAACCTAAAATTTGAAATCCTAGTTAATATTTGCAATTTAATTAT
AATATACCATCATTCTTTCGAATGGAAGTTCATAACTACCTATTTAAGTTAGTCTATTCTACTTTTAGGTCACTTCTCTGTAAATGTAAATCATCTAAAAAACTAGCTTATAAAAAGAGG
GTGTTCATAAAATTATAAACCCACTCCCTTATTTTATAACGATATAGTTTTCAATTCAACACACAACATTATGATTTTATATCTTCATGTCCAACCGGTCATAATAATCCGTGGATGGAG
ACCATAAATTCAGAAATCAAAGGTTATTATTTCATATATATTTTTATCTCTTAACTCAATTTTTTTTTATAATTAGTATATTTATCGTCGAATAATAATAATAATCCCTTACAAAAGTAA
TAAAAGACTAATCATAAAATATACTTCATTCCAACGAGGATGAAACTCCCCACCTTATAGGACCTCGAAATAATAAACAGAAATTGCAGCATTTTTCACGAGCTTACCAAAAGGATCGGG
CCGGATTAGGATAATATTTCCCAAGGAAGCCCAGCCCAATTAACTATTGTGTTTCTCTGTTTACAGGGCTGCGATGCCTCAGTAATGGTGGCATCACCGAACGGAGACGCAGAGAAAGAT
GCTCTGGACAATCTATCCCTGGCCGGCGACGGATTCGACGCCGTATCAAGAGCTAAAACAGCTGTAGAAGCTATATGCCCTGGAGTCGTTTCTTGTGCAGATATCATCGCCATCGCAGCT
CGTGATGTTGTCGCCTTG
GTATACGATTGTAAACTTGATTACAATTAAGCCAAATTAATCTTGATTTTGACTAACAACGAGCTTTAAAATTGTACAGGCAGGAGGCCCGACGTTCGCGGT
GGAATTAGGGCGGAGGGACGGCATGATATCCAGCGTATCCCTCGTCGCCGGAAACTTGCCGGAGCCAAACATGACCCTACCCGAACTCAACGCAATCTTCGCCAAACACAACCTCACCCA
ATTCGACATGATCGCGCTTTCGGGAGTTCACACGCTCGGCTTCTCCCACTGCAATCGATTCTTCAATCGCATCTACTCTTCCACAGTCGACCCTTCCCTGAACTCCACCTACGCCCAGCA
GCTGATGACGGCCTGCCCGAGGAACGTGGATCCCAGCATCCGCAATCGACATGGATCCGACGACTCCGAGGGCATTCGACAACGTGTATTACCAGAATCTGGTCGAGGGGAAGGGTATGT
TTAG

Retrieve as FASTA