Entry information : LuPrx204(Lus10039681|PACid:23165112)
Entry ID 12136
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx204(Lus10039681|PACid:23165112)
Name LuPrx204(Lus10039681|PACid:23165112)
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx204
start..stop
S start..stop
LuPrx144 652 0 1..328 1..328
PtPrx25 509 0 1..328 1..324
MePrx24 504 0 6..328 4..325
PtrtrPrx05 495 2e-178 12..328 8..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1161997..1162215 219 N° 2 1162392..1162583 192 N° 3 1162664..1162826 163 N° 4 1163266..1163678 413
join(1161997..1162215,1162392..1162583,1162664..1162826,1163266..1163678)


exon

Literature and cross-references LuPrx204(Lus10039681|PACid:23165112)
DNA ref. Phytozome 12:   scaffold15 (1161997..1163678)
Protein sequence: LuPrx204(Lus10039681|PACid:23165112)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (302)
PWM (Da):   %s   35837.27 (33019.8)  
PI (pH):   %s   8.21 (8.40) Peptide Signal:   %s   cut: 27 range:27-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MERLSFSSVALLVMVVALVSVESANAQLKMGFYSKSCPKAENIIQDFVHQHISNVPSLAATFIRMHFHDCFVRGCDASVLLNTTSGEQLEKQAPPNLTLRGFDFIDRVKSLVEAECPGVVSCADVLTLVTRDSIVAVGGPSWRVPTGRRDGVISRFSESLNNIPPPFANFTTLQIMFANQGLNVKDLVLLSGAHTIGISHCSSFSNRLYNFTGRGDADPALDTSYASNLRSRKCRSIGDNTTKVEMDPGSRNTFDLSYYSLLLKRRGLFESDAALITNSASLQLVEKITKGSVKDFFDEFALAMEKLGRVNVKTGSSGEIRKQCALVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAAGGCTTAGCTTTTCTTCTGTGGCATTACTTGTAATGGTGGTTGCTCTTGTTTCGGTCGAATCGGCCAATGCTCAGTTGAAGATGGGTTTTTACTCCAAGAGCTGCCCCAAAGCG
GAAAATATCATACAGGACTTCGTCCACCAGCACATCTCCAACGTCCCTTCTCTTGCCGCCACCTTCATCAGGATGCATTTCCATGACTGCTTTGTCAGG
GTTCGTTTCCACCTCTCAAAA
TCTTCTTAGTACCACATTGGTTGAATAAGACTCTTTATGTTGTTGGGATTGGCGTGTGAGTGAAAATGAAGAAATGATTTGAACTGGTATGGTTCTGGCCAAATCGATCCATATATAACC
GATTTTGGTTTTGACTATGTTTGTGTGTGTTCTAGGGATGTGATGCGTCGGTGCTCCTGAACACAACCTCAGGGGAGCAACTCGAGAAGCAAGCGCCTCCGAACCTGACACTTAGAGGGT
TCGACTTCATCGACAGGGTGAAGAGCCTCGTCGAAGCTGAATGCCCCGGAGTTGTCTCCTGTGCTGATGTTCTGACTTTGGTCACTAGGGACTCAATCGTTGCAGTT
GTACGTCGTATGT
CACATAACTTTGTAATCATGTGTGAAGTTTTTCAGGTTCTGATGATTCGTGGGTTTTTTTTCGACAGGGCGGTCCGTCCTGGAGAGTTCCTACGGGGCGAAGAGACGGGGTGATCTCTCG
GTTTTCGGAATCTCTGAACAACATTCCTCCTCCATTTGCCAACTTCACCACTCTCCAGATAATGTTTGCCAACCAAGGGCTTAATGTGAAAGACCTTGTGTTGCTTTCAG
GTAAATTCCC
AAAACGCTGCCATTTAGGGACTATAGTTGAAATTTTGGTTTGATCACGGTTTGACCGGACTAAACTCAGTTGATCACCAAAATTGCCACCGTGATTTCGACCGGTTTCATTTCAGCTCAC
TGTGACCATAACCGACTCGGCCAACCAAAATGTGGCATATTGGAGTTGTTTCGGCCCGGTTTAATCTGATAATTGAAATGAAATGAAATTCAATTTTCACTGAAAAAAGTTTAGACACAT
GGGGTTGGGACCATGAAATAGACCAAAAATTGTACATGATTGAAACCCGTAACCGCAATCAATCTCGAACTGACTGAAAGCAGTTTTGAATTCGATTAACCAAACATCAAATTCCGGTTT
GATTCGGAGCCCAACATGTAACATGTCATTAATTATAATTCATTTTTTCCATTTTTATTACTTTCTCAGGGGCTCATACTATTGGCATTTCACATTGCTCCTCATTCTCCAACCGGCTCT
ACAACTTCACAGGCAGGGGAGACGCCGATCCGGCCCTAGACACCAGCTACGCCTCGAATCTAAGGTCGAGAAAGTGTCGAAGCATCGGGGACAACACAACGAAGGTCGAGATGGACCCCG
GTAGCAGGAACACCTTTGACCTGAGCTACTACTCCTTGCTCCTGAAAAGGAGAGGACTGTTCGAGTCGGATGCTGCCCTGATAACCAACTCTGCCTCGTTGCAACTCGTCGAGAAGATCA
CGAAAGGCTCCGTGAAGGATTTCTTCGACGAGTTCGCTCTAGCCATGGAGAAGCTGGGTCGGGTGAATGTGAAAACCGGATCCAGTGGTGAGATCAGGAAGCAATGTGCTTTGGTTAATT
AA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAAGGCTTAGCTTTTCTTCTGTGGCATTACTTGTAATGGTGGTTGCTCTTGTTTCGGTCGAATCGGCCAATGCTCAGTTGAAGATGGGTTTTTACTCCAAGAGCTGCCCCAAAGCG
GAAAATATCATACAGGACTTCGTCCACCAGCACATCTCCAACGTCCCTTCTCTTGCCGCCACCTTCATCAGGATGCATTTCCATGACTGCTTTGTCAGG
GGATGTGATGCGTCGGTGCTC
CTGAACACAACCTCAGGGGAGCAACTCGAGAAGCAAGCGCCTCCGAACCTGACACTTAGAGGGTTCGACTTCATCGACAGGGTGAAGAGCCTCGTCGAAGCTGAATGCCCCGGAGTTGTC
TCCTGTGCTGATGTTCTGACTTTGGTCACTAGGGACTCAATCGTTGCAGTT
GGCGGTCCGTCCTGGAGAGTTCCTACGGGGCGAAGAGACGGGGTGATCTCTCGGTTTTCGGAATCTCTG
AACAACATTCCTCCTCCATTTGCCAACTTCACCACTCTCCAGATAATGTTTGCCAACCAAGGGCTTAATGTGAAAGACCTTGTGTTGCTTTCAG
GGGCTCATACTATTGGCATTTCACAT
TGCTCCTCATTCTCCAACCGGCTCTACAACTTCACAGGCAGGGGAGACGCCGATCCGGCCCTAGACACCAGCTACGCCTCGAATCTAAGGTCGAGAAAGTGTCGAAGCATCGGGGACAAC
ACAACGAAGGTCGAGATGGACCCCGGTAGCAGGAACACCTTTGACCTGAGCTACTACTCCTTGCTCCTGAAAAGGAGAGGACTGTTCGAGTCGGATGCTGCCCTGATAACCAACTCTGCC
TCGTTGCAACTCGTCGAGAAGATCACGAAAGGCTCCGTGAAGGATTTCTTCGACGAGTTCGCTCTAGCCATGGAGAAGCTGGGTCGGGTGAATGTGAAAACCGGATCCAGTGGTGAGATC
AGGAAGCAATGTGCTTTGGTTAATTAA

Retrieve as FASTA