Entry information : LuPrx208(Lus10041250|PACid:23179952)
Entry ID 12139
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx208(Lus10041250|PACid:23179952)
Name LuPrx208(Lus10041250|PACid:23179952)
Class Class III peroxidase    [Orthogroup: Prx229]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx208
start..stop
S start..stop
LuPrx207 393 2e-137 59..349 59..348
LuPrx120 383 2e-133 59..346 60..351
RcPrx24 369 5e-128 27..349 33..348
MePrx105 360 1e-124 61..349 57..344
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1614507..1614797 291 N° 2 1613997..1614188 192 N° 3 1613762..1613927 166 N° 4 1612787..1613187 401
complement(join(1612787..1613187,1613762..1613927,1613997..1614188,1614507..1614 797))


exon

Literature and cross-references LuPrx208(Lus10041250|PACid:23179952)
DNA ref. Phytozome 12:   scaffold280 (1614797..1612787)
Protein sequence: LuPrx208(Lus10041250|PACid:23179952)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   350 (327)
PWM (Da):   %s   37497.16 (35043.9) Transmb domain:   %s   o4-26i
PI (pH):   %s   6.92 (6.92) Peptide Signal:   %s   cut: 23 range:23-349
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSSTTMTTVVLILFFAVPLLSFSVADDHKQHEIGRRALIGQDDPINSTTATNSSAAPKDCPQVEAIARDVTWKRVAANPTLVPKLLRLHFHDCIIKGCDGAILLDSTANQKAEKDAIPNLSVSGYDVIDEIKAAVEKACPGTVSCADIVALAARDAVSFQFKKPIWAVTMGRKDSRVSKESDALTGLPTPDANFTELIQLFKTKGLDLEDLVVLSGAHTIGVSRCGAVIKRLYNFSGAGDTDPAMAPNYAQTLKSKCSNFNPNVQVELDPGSSGTFDTHYFKALNEKQGLLPSDVTLLTDPRSAEMSRKLAGNEQLFLDKFGKSMVKLGGLGMGVSEGEIRKNCHHVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTTCCTCCACCACCATGACCACCGTAGTTCTAATCTTGTTCTTTGCCGTGCCTCTGCTTTCGTTTTCGGTCGCCGACGATCATAAACAACATGAAATTGGGCGGCGGGCTCTGATC
GGCCAAGATGATCCGATCAACTCTACTACTGCTACTAATAGTTCAGCAGCACCAAAGGATTGCCCGCAGGTAGAAGCAATTGCCAGAGACGTCACCTGGAAAAGGGTTGCAGCTAACCCT
ACTTTGGTACCCAAGTTACTCAGGCTACATTTCCATGACTGCATTATTAAG
GTACATACATATAAAAACAGTGTTAATCCTCCCTTATCAACGAAACTCGAGTTATTGGGATGCTTCATA
TGGTATCAAAACTTTTAGCTGACAAAAGGTTAGAGTCTCAAATCCTATTGATCTCAAATCTATTGCACAAGGCTTACTGAAATAGTGCAAATTTCAGACTGTAGTTTGTTTTTTAGATTT
GACGGAGATTTAAAGAGTGATTTTGTGGATCCGGGTGTTTTGGTCGAAATGTCACGTTTGATTATGAAAATGAAGTGGGATTTGGAAGTGATTTCCAATCATCTTGTGGTTCCCCATCTA
TTAATGCAGGGTTGTGATGGAGCGATATTGTTGGATTCGACGGCTAACCAGAAAGCAGAGAAGGATGCTATTCCGAACTTGTCGGTATCGGGTTACGATGTAATCGACGAGATTAAAGCC
GCAGTCGAAAAGGCTTGCCCTGGGACAGTCTCTTGTGCTGACATCGTTGCCTTGGCTGCAAGAGATGCTGTTTCTTTTCAG
GTACGATTAAGTGATGAATTAATTAATCATATGTAATTA
AATCAATTAATCATATGCTTATTCATGCAGTTCAAAAAGCCAATCTGGGCGGTGACCATGGGTAGGAAAGATAGTCGAGTTTCCAAGGAATCAGATGCTTTAACAGGCTTGCCAACCCCT
GACGCCAACTTCACAGAACTCATTCAGCTATTCAAAACCAAAGGCCTCGATCTCGAGGACCTCGTCGTTTTGTCAG
GTACGTGTAGACATCATGCTGAATGATCACGAAATCACTTGCAT
ATCTAAAATCAACTTTTATCAGAAGATAGACAGGGGGAATACCTCGTTTAATTTTTTTTTGTTTCGAGCACCAAAATCGTGCATATATTTGTGCTTTTTATGAATTGGGTCAGTGCATTG
TTATGCTCGGCTCAATAATGTTTTGACTATGTGATGTATCAAATTTAAATAAATTATTCACGGCCTTAATAAGTAAAATCATAATTTAGTTCAAATAACCATTTTTTTTAAAACCCAACT
AGACCGGCCGGTCGGACTGATCCAACAGCAAAATGGGTCCTCGTACGGAAAAAATATATCCCACGACACATTAAATTATATTTCACTAAAATAAGTAGATCGAATACTGTTTTCTTGTGC
TGTGTAATTTAACTTAATATTAGTTTTACAAAATGGATTTTGTCAATTAATTACTTTATATACAAAATTTCACCGCAAAATTTTTTCTGCGTGTATATTTCAATTATGGTTCCGCCACTA
CATTAAATTCTGATGTCAACAATTATACTTTCAAATTTCGAACCGAGCAGGAGCGCACACAATCGGGGTCAGCCGATGCGGGGCGGTAATAAAGAGGCTATACAACTTCTCGGGAGCCGG
GGACACCGATCCAGCCATGGCACCAAATTACGCACAAACGCTCAAGTCGAAATGCTCGAATTTTAACCCTAATGTCCAAGTTGAGCTCGACCCCGGAAGCTCGGGCACCTTCGACACTCA
TTACTTCAAGGCCTTGAACGAAAAGCAAGGACTTTTACCGTCAGACGTTACGTTGCTGACGGACCCACGATCGGCCGAAATGAGCCGGAAATTGGCAGGCAACGAACAGCTTTTCCTTGA
CAAGTTTGGTAAGTCTATGGTGAAGTTGGGCGGCCTTGGCATGGGAGTTAGTGAAGGTGAGATTAGGAAAAATTGTCACCATGTTAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTTCCTCCACCACCATGACCACCGTAGTTCTAATCTTGTTCTTTGCCGTGCCTCTGCTTTCGTTTTCGGTCGCCGACGATCATAAACAACATGAAATTGGGCGGCGGGCTCTGATC
GGCCAAGATGATCCGATCAACTCTACTACTGCTACTAATAGTTCAGCAGCACCAAAGGATTGCCCGCAGGTAGAAGCAATTGCCAGAGACGTCACCTGGAAAAGGGTTGCAGCTAACCCT
ACTTTGGTACCCAAGTTACTCAGGCTACATTTCCATGACTGCATTATTAAG
GGTTGTGATGGAGCGATATTGTTGGATTCGACGGCTAACCAGAAAGCAGAGAAGGATGCTATTCCGAAC
TTGTCGGTATCGGGTTACGATGTAATCGACGAGATTAAAGCCGCAGTCGAAAAGGCTTGCCCTGGGACAGTCTCTTGTGCTGACATCGTTGCCTTGGCTGCAAGAGATGCTGTTTCTTTT
CAG
TTCAAAAAGCCAATCTGGGCGGTGACCATGGGTAGGAAAGATAGTCGAGTTTCCAAGGAATCAGATGCTTTAACAGGCTTGCCAACCCCTGACGCCAACTTCACAGAACTCATTCAG
CTATTCAAAACCAAAGGCCTCGATCTCGAGGACCTCGTCGTTTTGTCAG
GAGCGCACACAATCGGGGTCAGCCGATGCGGGGCGGTAATAAAGAGGCTATACAACTTCTCGGGAGCCGGG
GACACCGATCCAGCCATGGCACCAAATTACGCACAAACGCTCAAGTCGAAATGCTCGAATTTTAACCCTAATGTCCAAGTTGAGCTCGACCCCGGAAGCTCGGGCACCTTCGACACTCAT
TACTTCAAGGCCTTGAACGAAAAGCAAGGACTTTTACCGTCAGACGTTACGTTGCTGACGGACCCACGATCGGCCGAAATGAGCCGGAAATTGGCAGGCAACGAACAGCTTTTCCTTGAC
AAGTTTGGTAAGTCTATGGTGAAGTTGGGCGGCCTTGGCATGGGAGTTAGTGAAGGTGAGATTAGGAAAAATTGTCACCATGTTAACTGA

Retrieve as FASTA