Entry information : LuPrx29(Lus10005679|PACid:23168879)
Entry ID 12149
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx29(Lus10005679|PACid:23168879)
Name LuPrx29(Lus10005679|PACid:23168879)
Class Class III peroxidase    [Orthogroup: Prx019]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx29
start..stop
S start..stop
LuPrx110 593 0 1..324 1..330
LuPrx13 457 2e-163 4..319 5..330
LuPrx77 454 5e-162 4..319 5..331
PpePrx32 419 2e-148 27..321 22..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 111692..111907 216 N° 2 112107..112871 765  
join(111692..111907,112107..112871)


exon

Literature and cross-references LuPrx29(Lus10005679|PACid:23168879)
DNA ref. Phytozome 12:   scaffold911 (111692..112871)
Protein sequence: LuPrx29(Lus10005679|PACid:23168879)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (300)
PWM (Da):   %s   34618.71 (31830.2) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.83 (8.77) Peptide Signal:   %s   cut: 27 range:27-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLAKTSILVVVFLLCNVFGLVPSVTGLQVGFYRSTCPQAETIVQNLVQKQFGTDKSIAAALIRMHFHDCFVRGCDASILIDSTPQKQSEKSAGPNRSVRGFELIDSIKSALESACPSRVSCADIIALATRDVVALAGGPTYQLPTGRLDGLISNPGIVNLPGPTVPVTQAFNQFFRPLGFTLTEMVTLLGGHTVGVAHCNFFQDRISNFQGTGRPDPSMDPNLAASLRQTCAGSNNPTAFLDQNTSFVVDNSFYREIGLKKGVMLIDQAIATDRSTSAIVSGLARSEAGFRQGFAAAMVKMGNLVGSGGEIRKSCRVFNPKKAGGS*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTAGCCAAAACATCCATACTTGTGGTTGTGTTCCTTCTATGTAATGTCTTCGGTTTGGTTCCCTCGGTGACCGGTTTACAAGTCGGGTTTTACCGGTCGACTTGCCCACAGGCTGAA
ACTATTGTGCAGAATTTGGTTCAGAAGCAGTTTGGCACTGATAAGTCCATCGCCGCCGCTCTCATTCGCATGCACTTCCACGACTGTTTCGTTAGG
GTAAGACTATACTTTCCCTCCCCT
TACAATACAATGTTTTTTTTGTTAATCGTGAGTCGAATGTTCACGAGATGGATGACCTAGTGACGATGACATCATCGATGTCTAGTGGTCTAGTGGTCTAGCTAGAGAGGTATATGAATT
GTTCAAAGTCTACGAATATGTGAACTTGATGATAGTTTTCTTTCATCATATGTAGGGTTGCGATGCGTCGATCCTAATCGATTCGACTCCTCAAAAGCAATCCGAGAAATCAGCCGGCCC
GAACCGATCGGTCAGAGGATTCGAATTGATCGACTCGATCAAATCAGCGCTCGAATCCGCATGCCCTTCTAGAGTCTCTTGTGCAGACATCATCGCTCTAGCCACCCGCGATGTGGTCGC
CCTAGCCGGAGGCCCCACATACCAACTCCCTACGGGACGGCTTGATGGCCTAATCTCGAACCCGGGCATCGTCAACCTCCCTGGTCCAACCGTACCGGTTACTCAAGCATTCAACCAGTT
TTTCCGACCCTTGGGCTTCACCCTAACAGAAATGGTCACCCTTTTAGGGGGCCACACGGTTGGTGTGGCCCATTGCAATTTCTTCCAGGACCGGATCTCTAACTTCCAGGGCACAGGTCG
TCCTGACCCGTCGATGGACCCGAACTTGGCCGCCAGCCTCCGTCAGACTTGCGCCGGGAGCAACAATCCGACGGCCTTTTTGGACCAGAACACTTCGTTCGTTGTTGATAATTCGTTCTA
CAGGGAGATTGGTTTGAAGAAGGGCGTGATGCTGATTGATCAGGCGATTGCTACCGACCGGTCTACGTCGGCGATCGTGTCCGGTTTGGCGAGGAGCGAGGCGGGTTTCCGGCAGGGGTT
TGCAGCGGCGATGGTGAAGATGGGGAATCTAGTTGGGAGTGGAGGAGAAATCAGGAAGAGCTGTCGGGTTTTCAATCCGAAGAAGGCCGGCGGTAGTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTAGCCAAAACATCCATACTTGTGGTTGTGTTCCTTCTATGTAATGTCTTCGGTTTGGTTCCCTCGGTGACCGGTTTACAAGTCGGGTTTTACCGGTCGACTTGCCCACAGGCTGAA
ACTATTGTGCAGAATTTGGTTCAGAAGCAGTTTGGCACTGATAAGTCCATCGCCGCCGCTCTCATTCGCATGCACTTCCACGACTGTTTCGTTAGG
GGTTGCGATGCGTCGATCCTAATC
GATTCGACTCCTCAAAAGCAATCCGAGAAATCAGCCGGCCCGAACCGATCGGTCAGAGGATTCGAATTGATCGACTCGATCAAATCAGCGCTCGAATCCGCATGCCCTTCTAGAGTCTCT
TGTGCAGACATCATCGCTCTAGCCACCCGCGATGTGGTCGCCCTAGCCGGAGGCCCCACATACCAACTCCCTACGGGACGGCTTGATGGCCTAATCTCGAACCCGGGCATCGTCAACCTC
CCTGGTCCAACCGTACCGGTTACTCAAGCATTCAACCAGTTTTTCCGACCCTTGGGCTTCACCCTAACAGAAATGGTCACCCTTTTAGGGGGCCACACGGTTGGTGTGGCCCATTGCAAT
TTCTTCCAGGACCGGATCTCTAACTTCCAGGGCACAGGTCGTCCTGACCCGTCGATGGACCCGAACTTGGCCGCCAGCCTCCGTCAGACTTGCGCCGGGAGCAACAATCCGACGGCCTTT
TTGGACCAGAACACTTCGTTCGTTGTTGATAATTCGTTCTACAGGGAGATTGGTTTGAAGAAGGGCGTGATGCTGATTGATCAGGCGATTGCTACCGACCGGTCTACGTCGGCGATCGTG
TCCGGTTTGGCGAGGAGCGAGGCGGGTTTCCGGCAGGGGTTTGCAGCGGCGATGGTGAAGATGGGGAATCTAGTTGGGAGTGGAGGAGAAATCAGGAAGAGCTGTCGGGTTTTCAATCCG
AAGAAGGCCGGCGGTAGTTGA

Retrieve as FASTA