Entry information : LuPrx61(Lus10009933|PACid:23150079)
Entry ID 12170
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2016-01-16 (Christophe Dunand)
Sequence status complete
Reviewer Bruno Savelli
Last annotation changes 2020-09-30 (Bruno Savelli)
Peroxidase information: LuPrx61(Lus10009933|PACid:23150079)
Name LuPrx61(Lus10009933|PACid:23150079)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx61
start..stop
S start..stop
LuPrx62 575 0 1..285 3..287
LuPrx170 571 0 46..328 1..283
LuPrx171 517 0 1..328 3..327
LuPrx02 501 0 1..328 2..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2..235 234 N° 2 495..686 192 N° 3 799..967 169 N° 4 1051..1442 392
join(2..235,495..686,799..967,1051..1442)


exon

Literature and cross-references LuPrx61(Lus10009933|PACid:23150079)
DNA ref. Phytozome 12:   scaffold200 (190335..188927)
Protein sequence: LuPrx61(Lus10009933|PACid:23150079)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (297)
PWM (Da):   %s   35117.18 (31960.5) Transmb domain:   %s   i13-35o
PI (pH):   %s   10.57 (10.52) Peptide Signal:   %s   cut: 32 range:32-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAGSSNILRRSCLVTVAVAFLVLLAAGKCSAQLSTNFYSKRCPNLMKTVRSAVQSAVSKETRVAASLIRLHFHDCFVNGCDGSILLEDTASFTGEQTALPNAGSVRGFNVIKDIKSKVEKVCPGVVSCADILAIAARDSTAIAGGKSWKVRLGRRDSKTASLAAANSGVIPPPTATLNQLITRFQARGLSAKDMVVLSGSHTIGQARCVTFRNRIYNETNIDSSFARARQSKCPRAQNSGNNNLAPFDVTTPNLFDNKYYQNLIQQKGLLHSDQVLFNGGSTDSLVRSYSRKPKAFAADFASAMIKMGNISPLTGSQGEIRKICSRPN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCCGCCGGTAGTTCAAATATTCTGCGACGTTCATGTTTGGTGACGGTGGCGGTGGCTTTCCTTGTGTTGCTGGCTGCCGGGAAATGTTCGGCTCAGCTCTCCACGAATTTCTATTCAAAG
AGGTGTCCCAATCTGATGAAGACAGTGAGATCCGCCGTGCAATCCGCCGTCTCCAAGGAAACAAGGGTGGCTGCCTCTCTTATCCGCTTGCATTTCCACGATTGTTTCGTCAAT
GTACGT
AATTACTTTCTTTAACTTAAGAAAATGTGGTTTTGTCTCATGATATTGAGAGAAAATTGACAATCATGCCTGCCAATAAATTAGGGACCCACTAATTTTTACCGTGTTATAATTAAAATG
AATCCTTGTGGGCCCCAATTTATTGGCAGTGAGATAGACAATTTTATTAAATTGTGAGACAAGAAACATTTTGCCGTAGATTAATACTATATATTACGTTAATTGATGAGTTTTTTGGTG
TTGGCTAAGACAGGGTTGTGATGGATCGATACTGCTGGAAGACACGGCTTCGTTCACAGGAGAACAAACTGCTCTGCCCAACGCAGGATCAGTGAGAGGATTTAACGTAATCAAAGACAT
AAAGTCCAAGGTTGAGAAAGTCTGCCCAGGCGTCGTCTCCTGTGCCGACATCCTAGCCATCGCTGCTCGAGATTCCACCGCCATT
GTACGAACACTACTCCATCTTAAATGAAACATCTT
ATCTACCGTCCATTTCGATCTCTTGATCAATTGATTGATTCTCATGGATGGATCGATTATACTTAAATTACTTGCAGGCAGGGGGCAAAAGTTGGAAGGTGAGGCTTGGAAGGAGGGATT
CCAAAACAGCCAGTTTGGCTGCAGCAAACAGTGGAGTTATCCCTCCCCCTACCGCCACTCTTAACCAACTCATCACTCGCTTCCAAGCCAGAGGCCTCTCCGCTAAGGACATGGTCGTTC
TCTCTG
GTAAGCAGCGGTAGATCAGGATGTGCGTATTGGACCGACTTGTATAGAATGTTAAATTCATTTCAAATTAATTTTGGCTGCAGGATCCCACACGATTGGACAAGCAAGGTGCGT
AACATTCAGGAACAGAATCTACAACGAGACCAACATCGACTCTTCGTTCGCAAGAGCCAGACAGAGCAAGTGCCCCAGGGCTCAAAACTCGGGGAACAATAATTTGGCCCCATTCGACGT
TACGACCCCCAACTTGTTCGACAACAAGTACTACCAGAACCTCATCCAGCAAAAGGGTCTTCTCCACTCCGACCAAGTCTTGTTCAACGGTGGATCGACTGATTCCCTTGTACGATCTTA
CAGCAGGAAACCAAAGGCCTTCGCCGCGGACTTTGCATCTGCGATGATCAAGATGGGAAATATTAGTCCCCTCACTGGCTCTCAAGGCGAGATCAGGAAGATATGCAGCAGGCCTAACTA
A

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCCGCCGGTAGTTCAAATATTCTGCGACGTTCATGTTTGGTGACGGTGGCGGTGGCTTTCCTTGTGTTGCTGGCTGCCGGGAAATGTTCGGCTCAGCTCTCCACGAATTTCTATTCAAAG
AGGTGTCCCAATCTGATGAAGACAGTGAGATCCGCCGTGCAATCCGCCGTCTCCAAGGAAACAAGGGTGGCTGCCTCTCTTATCCGCTTGCATTTCCACGATTGTTTCGTCAAT
GGTTGT
GATGGATCGATACTGCTGGAAGACACGGCTTCGTTCACAGGAGAACAAACTGCTCTGCCCAACGCAGGATCAGTGAGAGGATTTAACGTAATCAAAGACATAAAGTCCAAGGTTGAGAAA
GTCTGCCCAGGCGTCGTCTCCTGTGCCGACATCCTAGCCATCGCTGCTCGAGATTCCACCGCCATT
GCAGGGGGCAAAAGTTGGAAGGTGAGGCTTGGAAGGAGGGATTCCAAAACAGCC
AGTTTGGCTGCAGCAAACAGTGGAGTTATCCCTCCCCCTACCGCCACTCTTAACCAACTCATCACTCGCTTCCAAGCCAGAGGCCTCTCCGCTAAGGACATGGTCGTTCTCTCTG
GATCC
CACACGATTGGACAAGCAAGGTGCGTAACATTCAGGAACAGAATCTACAACGAGACCAACATCGACTCTTCGTTCGCAAGAGCCAGACAGAGCAAGTGCCCCAGGGCTCAAAACTCGGGG
AACAATAATTTGGCCCCATTCGACGTTACGACCCCCAACTTGTTCGACAACAAGTACTACCAGAACCTCATCCAGCAAAAGGGTCTTCTCCACTCCGACCAAGTCTTGTTCAACGGTGGA
TCGACTGATTCCCTTGTACGATCTTACAGCAGGAAACCAAAGGCCTTCGCCGCGGACTTTGCATCTGCGATGATCAAGATGGGAAATATTAGTCCCCTCACTGGCTCTCAAGGCGAGATC
AGGAAGATATGCAGCAGGCCTAACTAA

Retrieve as FASTA