Entry information : LuPrx62(Lus10009934|PACid:23150133)
Entry ID 12171
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrx62(Lus10009934|PACid:23150133)
Name LuPrx62(Lus10009934|PACid:23150133)
Class Class III peroxidase     [Orthogroup: Prx008]*
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx62
start..stop
S start..stop
LuPrx61 575 0 3..287 1..285
LuPrx170 486 4e-176 48..287 1..240
CclPrx07 443 2e-158 13..291 7..284
CsPrx15 443 2e-158 13..291 7..284
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 200584..200823 240 N° 2 200133..200324 192 N° 3 199852..200020 169 N° 4 199509..199768 260
N° 5 199295..199309 15  
complement(join(199295..199309,199509..199768,199852..200020,200133..200324,2005 84..200823))


exon

Literature and cross-references LuPrx62(Lus10009934|PACid:23150133)
DNA ref. Phytozome 12:   scaffold200 (200823..199295)
Protein sequence: LuPrx62(Lus10009934|PACid:23150133)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   291 (258)
PWM (Da):   %s   31005.91 (27712.2) Transmb domain:   %s   i13-35o
PI (pH):   %s   10.08 (10.20) Peptide Signal:   %s   cut: 34 range:34-291
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSAAGSSNMLRRSCLVTIAVAFLVLLAAGECSAQLSTNFYSKRCPLLMKTVRSAVQSAVSKETRMAASLIRLHFHDCFVNGCDGSILLEDTASFTGEQTALPNAGSVRGFNVIKDIKSKVEKVCPGVVSCADILAIAARDSTAIAGGKSWKVRLGRRDSKTASLAAANSGVIPPPTATLNQLITRFQARGLSAKDMVVLSGSHTIGQARCVTFRNRIYNETNIDSSFARARQSKCPRAQNSGNNNLAPFDVTTPNLFDNKYYQNLIQQKGLLHSDQVLFNGGSTDSGLTW*

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction. 3' end is missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGCCGCCGGTAGTTCAAATATGCTGCGACGTTCATGTTTGGTGACGATTGCGGTGGCTTTCCTTGTGTTGTTGGCTGCCGGGGAATGTTCGGCTCAGCTCTCCACAAATTTCTAT
TCGAAGAGGTGTCCTCTTCTGATGAAAACAGTGAGATCAGCCGTTCAATCCGCCGTCTCCAAGGAAACAAGGATGGCTGCCTCTCTCATCCGCTTGCATTTCCACGATTGTTTCGTCAAT
GTACGTAATTACTTTCTTTAACTTAAGAAAATGTGGTTTTGTCTCATGATATTGAGAGAAAATTGACAATCATGCCTGCCAATAAATTAGGGACCCACTAATTTTTACCGTGTTATAATT
AAAATGAATCCTTGTGGGCCCCAATTTATTGGCAGTGAGATAGACAATTTTATTAAATTGTGAGACAAGAAACATTTTGCCGTAGATTAATACTATATATTACGTTAATTGATGAGTTTT
TTGGTGTTGGCTAAGACAGGGTTGTGATGGATCGATACTGCTGGAAGACACGGCTTCGTTCACAGGAGAACAAACTGCTCTGCCCAACGCAGGATCAGTGAGAGGATTTAACGTAATCAA
AGACATAAAGTCCAAGGTTGAGAAAGTCTGCCCAGGCGTCGTCTCCTGTGCCGACATCCTAGCCATCGCTGCTCGAGATTCCACCGCCATT
GTACGAACACTACTCCATCTTAAATGAAA
CATCTTATCTACCGTCCATTTCGATCTCTTGATCAATTGATTGATTCTCATGGATGGATCGATTATACTTAAATTACTTGCAGGCAGGGGGCAAAAGTTGGAAGGTGAGGCTTGGAAGGA
GGGATTCCAAAACAGCCAGTTTGGCTGCAGCAAACAGTGGAGTTATCCCTCCCCCTACCGCCACTCTTAACCAACTCATCACTCGCTTCCAAGCCAGAGGCCTCTCCGCTAAGGACATGG
TCGTTCTCTCTG
GTAAGCAGCGGTAGATCAGGATGTGCGTATTGGACCGACTTGTATAGAATGTTAAATTCATTTCAAATTAATTTTGGCTGCAGGATCCCACACGATTGGACAAGCAAG
GTGCGTAACATTCAGGAACAGAATCTACAACGAGACCAACATCGACTCTTCGTTCGCAAGAGCCAGACAGAGCAAGTGCCCCAGGGCTCAAAACTCGGGGAACAATAATTTGGCCCCATT
CGACGTTACGACCCCCAACTTGTTCGACAACAAGTACTACCAGAACCTCATCCAGCAAAAGGGTCTTCTCCACTCTGACCAAGTCTTGTTCAACGGTGGATCGACTGATTCCCTT
GTACG
ATCTTACAGCTCTTTTATTTCTATGGATTTAAAAAATTGTTTAAAAAAGTCCAAAATACATACCCAATAATATGTAATAGGAAACCGCTAGAAATCAAAATTAAGATTTTTATAATCGAA
AGCATATACATCCTCACAACAACCATCAAAACTTTTGAAAATATCTTTTAATTTTGTTTGTCTATTATTTGAAGGGGTTAACATGGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGCCGCCGGTAGTTCAAATATGCTGCGACGTTCATGTTTGGTGACGATTGCGGTGGCTTTCCTTGTGTTGTTGGCTGCCGGGGAATGTTCGGCTCAGCTCTCCACAAATTTCTAT
TCGAAGAGGTGTCCTCTTCTGATGAAAACAGTGAGATCAGCCGTTCAATCCGCCGTCTCCAAGGAAACAAGGATGGCTGCCTCTCTCATCCGCTTGCATTTCCACGATTGTTTCGTCAAT
GGTTGTGATGGATCGATACTGCTGGAAGACACGGCTTCGTTCACAGGAGAACAAACTGCTCTGCCCAACGCAGGATCAGTGAGAGGATTTAACGTAATCAAAGACATAAAGTCCAAGGTT
GAGAAAGTCTGCCCAGGCGTCGTCTCCTGTGCCGACATCCTAGCCATCGCTGCTCGAGATTCCACCGCCATT
GCAGGGGGCAAAAGTTGGAAGGTGAGGCTTGGAAGGAGGGATTCCAAA
ACAGCCAGTTTGGCTGCAGCAAACAGTGGAGTTATCCCTCCCCCTACCGCCACTCTTAACCAACTCATCACTCGCTTCCAAGCCAGAGGCCTCTCCGCTAAGGACATGGTCGTTCTCTCT
G
GATCCCACACGATTGGACAAGCAAGGTGCGTAACATTCAGGAACAGAATCTACAACGAGACCAACATCGACTCTTCGTTCGCAAGAGCCAGACAGAGCAAGTGCCCCAGGGCTCAAAAC
TCGGGGAACAATAATTTGGCCCCATTCGACGTTACGACCCCCAACTTGTTCGACAACAAGTACTACCAGAACCTCATCCAGCAAAAGGGTCTTCTCCACTCTGACCAAGTCTTGTTCAAC
GGTGGATCGACTGATTCCCTT
GGGTTAACATGGTGA

Retrieve as FASTA