Entry information : LuPrx72 (Lus10012540|PACid:23143830)
Entry ID 12179
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-09-29 (Christophe Dunand)
Peroxidase information: LuPrx72 (Lus10012540|PACid:23143830)
Name (synonym) LuPrx72 (Lus10012540|PACid:23143830)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue types Embryos
Seed coats
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrx72
start..stop
S start..stop
LuPrx191 478 1e-171 15..334 8..327
MePrx64 472 4e-169 18..334 8..323
LuPrx176 469 3e-168 15..334 7..326
PtPrx82 465 2e-166 19..334 6..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 203527..203766 240 N° 2 203863..204054 192 N° 3 204214..204786 573  
join(203527..203766,203863..204054,204214..204786)


exon

Literature and cross-references LuPrx72 (Lus10012540|PACid:23143830)
DNA ref. Phytozome 11:   scaffold6 (203527..204786)
EST ref. GenBank:   JG097848.1 [3' end]
Protein sequence: LuPrx72 (Lus10012540|PACid:23143830)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (302)
PWM (Da):   %s   35404.37 (32101.8)  
PI (pH):   %s   6.02 (5.33) Peptide Signal:   %s   cut: 33 range:33-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSSRGCCSNGTTITAAMMIMVVVSITRTATGQQLTENYYIGSCPNVEAVVQKVIAAKARKQFATIPGTLRLFFHDCFVTGCDASVMVASPNGDAEKDAPENLSLAGDGFDTIIRAKTAVEAVCPGVVSCADIMAIAARDVLALVGGPSFKVELGRRDGVISSASLVAGNLPEPSMSLPQLNAIFAKHNLTQFDMIALSGAHTLGFSHCSRLSNRLYSWLPNSSVDPSLDPSYSQVLMDHCPRDANPEAIADMDPTTPRRFDNAYYQNLVGGKGMFTSDQVLFTDSRSQPTVLDFANNAGDFNAAFTVAMRKLGRAGVKTGGEGSIRSDCTIMN*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 3 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGTCAAGCAGAGGTTGCTGCTCCAATGGTACTACCATCACGGCAGCCATGATGATCATGGTGGTGGTTTCAATCACCAGAACGGCGACAGGACAACAGCTGACGGAGAACTACTAC
ATTGGAAGCTGCCCGAACGTGGAGGCGGTAGTACAGAAGGTGATAGCGGCCAAAGCACGCAAGCAGTTCGCAACCATCCCGGGCACGCTCCGTCTCTTTTTCCATGACTGCTTCGTTACT
GTAAGTAAGATCATATTTATATCTAAAACTGACGAGTAATTACCATCAATGTGATTGATTGATGTCATGAAATGCGTACATATATATATGATACAGGGGTGTGACGCTTCAGTAATGGTG
GCATCACCGAATGGAGATGCAGAGAAAGATGCTCCGGAGAACCTTTCCCTGGCCGGAGATGGCTTCGACACAATCATAAGAGCCAAAACTGCCGTAGAAGCTGTATGCCCTGGAGTTGTT
TCTTGTGCAGACATCATGGCCATTGCTGCTCGTGATGTCCTAGCATTG
GTACGCTTAATTAATTGATCATTATTAAGAGGCAGAGAACCCTCACAAATTCTGATTTATTTGGGTCATGAA
TTTCTCACATGTTAGATGGTATAAATGTTTAGTGTTCAAATCTTACTATTTTACTTACTAATATGCATATGTGCATCAATTGATCAGGTTGGAGGGCCTTCATTCAAGGTCGAATTGGGG
CGAAGAGACGGAGTCATATCCAGTGCATCTCTTGTGGCAGGAAACCTCCCTGAACCGAGCATGTCTCTGCCTCAACTCAATGCCATTTTCGCCAAACACAACCTTACCCAATTCGACATG
ATCGCCCTGTCGGGAGCCCACACGCTCGGCTTCTCCCACTGCAGCCGTCTATCGAACCGCCTCTACTCGTGGTTGCCAAACTCCTCTGTCGATCCTTCCTTGGATCCGAGCTATTCCCAG
GTGCTGATGGACCACTGCCCGCGGGATGCGAACCCTGAGGCTATAGCCGACATGGATCCGACAACTCCGAGGAGATTCGACAATGCCTACTACCAGAACCTGGTTGGTGGTAAGGGCATG
TTTACCTCGGACCAGGTGCTGTTTACGGACTCCAGGTCCCAGCCCACCGTGCTGGATTTCGCGAACAATGCTGGCGATTTCAATGCGGCCTTCACAGTGGCGATGAGGAAGCTGGGGCGA
GCCGGGGTCAAGACTGGTGGAGAAGGAAGCATTAGGAGTGACTGTACGATTATGAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGTCAAGCAGAGGTTGCTGCTCCAATGGTACTACCATCACGGCAGCCATGATGATCATGGTGGTGGTTTCAATCACCAGAACGGCGACAGGACAACAGCTGACGGAGAACTACTAC
ATTGGAAGCTGCCCGAACGTGGAGGCGGTAGTACAGAAGGTGATAGCGGCCAAAGCACGCAAGCAGTTCGCAACCATCCCGGGCACGCTCCGTCTCTTTTTCCATGACTGCTTCGTTACT
GGGTGTGACGCTTCAGTAATGGTGGCATCACCGAATGGAGATGCAGAGAAAGATGCTCCGGAGAACCTTTCCCTGGCCGGAGATGGCTTCGACACAATCATAAGAGCCAAAACTGCCGTA
GAAGCTGTATGCCCTGGAGTTGTTTCTTGTGCAGACATCATGGCCATTGCTGCTCGTGATGTCCTAGCATTG
GTTGGAGGGCCTTCATTCAAGGTCGAATTGGGGCGAAGAGACGGAGTC
ATATCCAGTGCATCTCTTGTGGCAGGAAACCTCCCTGAACCGAGCATGTCTCTGCCTCAACTCAATGCCATTTTCGCCAAACACAACCTTACCCAATTCGACATGATCGCCCTGTCGGGA
GCCCACACGCTCGGCTTCTCCCACTGCAGCCGTCTATCGAACCGCCTCTACTCGTGGTTGCCAAACTCCTCTGTCGATCCTTCCTTGGATCCGAGCTATTCCCAGGTGCTGATGGACCAC
TGCCCGCGGGATGCGAACCCTGAGGCTATAGCCGACATGGATCCGACAACTCCGAGGAGATTCGACAATGCCTACTACCAGAACCTGGTTGGTGGTAAGGGCATGTTTACCTCGGACCAG
GTGCTGTTTACGGACTCCAGGTCCCAGCCCACCGTGCTGGATTTCGCGAACAATGCTGGCGATTTCAATGCGGCCTTCACAGTGGCGATGAGGAAGCTGGGGCGAGCCGGGGTCAAGACT
GGTGGAGAAGGAAGCATTAGGAGTGACTGTACGATTATGAATTGA

Retrieve as FASTA