Entry information : LuPrxII206(Lus10041218|PACid:23179760)
Entry ID 12194
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrxII206(Lus10041218|PACid:23179760)
Name LuPrxII206(Lus10041218|PACid:23179760)
Class Atypical 2-Cysteine peroxiredoxin (type II)     [Orthogroup: PrxII002]*
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrxII206
start..stop
S start..stop
LuPrxII119 285 3e-98 1..144 83..226
CclPrxII05 256 5e-87 1..146 52..197
CsPrxII05 254 7e-87 1..146 31..176
NtPrxII06a 251 9e-86 1..146 21..166
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1479713..1479844 132 N° 2 1479601..1479630 30 N° 3 1479228..1479386 159 N° 4 1479045..1479139 95
N° 5 1477760..1477922 163 N° 6 1477543..1477671 129  
complement(join(1477543..1477671,1477760..1477922,1479045..1479139,1479228..1479 386,1479601..1479630,1479713..1479844))


exon

Literature and cross-references LuPrxII206(Lus10041218|PACid:23179760)
DNA ref. Phytozome 11:   scaffold280 (1479844..1477543)
Protein sequence: LuPrxII206(Lus10041218|PACid:23179760)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   235
PWM (Da):   %s   25972.31  
PI (pH):   %s   9.91
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
SYTKVAVGADLVSPSPDVALQKARTWDEGVSSKFSTTPLKDIFKGKKVVIFGLPGAYTGVCSQQHVPSYKNNADKFKAKGIDSIICVSVNDPYVMNGWAEKLQAKDDLEFYGDFDGKFHKSLELTKDLSGALLGPRSERLQKRVREVAFGSSSCDCGSKFPPQHQEEQPGKEYLMHPLPQPLNPDCKPSNKLGKVALVTGGNSGIGRSVCLHFANGRSDRRIQLRQRSRRYRQE*

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction. 5' end is missing due to NNNNN.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCCTACACCAAGGTTGCTGTTGGGGCTGATTTAGTATCGCCCTCCCCCGATGTCGCCCTCCAGAAAGCTCGCACCTGGGACGAAGGCGTCTCTTCCAAATTCTCCACTACCCCTCTCAAA
GACATTTTCAAG
GTCCAAATCCACTGCCATTTTTGTACTTATTTTTCTAGATTCCACTATTTTTTTAACTGATTCCTTTATTTTTATGTTCCAGGGCAAGAAAGTTGTCATCTTTGGTCT
TCCA
GTAAGTCTCTCTTAACTGTAAAATTGTTGCTTTGGTTGCTCTTTGCTGTGATTGAGTTATCATATTTCTGTCCTGTACGGAAATTCGATGTGAATTTCATTTGGAAATGTCTGGCA
AGATTATTGAGGTCAGAAACTCCTGAAACGAGCCAGCTCATTCAAAAGTTCCAATGGCTTTTGGTAATGTCTTGTTTGGCATTTGCTTTTATCTCCAGGGTGCATACACAGGTGTTTGCT
CGCAGCAGCATGTTCCTAGTTACAAGAACAACGCAGACAAGTTCAAGGCTAAAGGGATTGATTCGATCATTTGCGTGTCCGTTAACGACCCGTATGTGATGAATGGTTGGGCAGAGAAAC
TTCAAGCTAAAGATGAT
GTAAGTTAGTTAACAAAAGGATGAGCCTTTTGCTTCCTCTAGTATATTATCTATGACTTTACACGTGCTCTTTCACTCCCCGTCTCAGCTCGAATTCTACGGA
GACTTTGATGGGAAGTTCCACAAGAGCTTGGAGTTAACTAAGGATCTCTCTGGTGCTTTGCTTGGACCTCGCTCTGAAAG
GTATATATACTATTGCGTCTGTAATATCCAAGACATGTCT
GATACTGTCCTTTTCTTACTGTGATCATTGAGGATTTGTCTGTGTAGATGGTCTGCGTATGTTGATGATGGGAAAGTTAAGGTTCTTAATGTCGAGGAAGTCCCGTCCGATTTCAAGGTT
TCTGGCGGTGAGGTTATTTTGGGACAGATATGAATCCGAGTGAAATGACAATAAGAGGGACGCGGCAATAGAACATTCACAGCTGCTGTTGCTGCTGGCGAAGATGCCGATCCAGTGTGT
TTGGTCGTGTTGTTGTTTGGATCATATGTTTGTTACATTTCTTGGGACAAGTTAGTTTTTGTCTACTCAATTTCTTCACACATACATGTTGAAGAACACAAACACTCTGAAAGTTTAGCA
ATAGGAATCATAATTTTTAAAAATGTAAAATTAGAATAATATAAAATAATTAAATTGAAGTTGGATGGGGATTGTAAAAAAAATATAAAATTAAAGGATATAAAAAATTTGTAGGAAATT
TTATTTTCTCATGGAATAAATAGGGAAACATAATTTCAATCAGAATTTTTATATTTTTTTATTTAAGTTTTTATTCATGATATTTTTCTACTTTAACTCAACTTATTTATATTAATTTCA
ATTCATCTTTCTTAAGAATCATGATTTCTATTATCAAATATAGAAGAAGTGATTGAATCAAGTAGTTGTTTTTCTGGCCGGTTTCGTTTACAAAGATGAATTGATCCTAACAGTAAATGT
AAAAGCTTTTTCAGCCAAGGGAGGTTGCGGAATTATTTGCCATTCTTCAAGGCTTGATTTGGTAGGTGGATAAAATTTACATGATAATAAAAAAATTTGATTTCAAAATTACATGATAAT
AACAAACAGATTGCGTCCATGTATTTCAAGTTTCCAATTTCCTGAGGGTTCATTTACTAGACGTGACGGAAATTTATCATCTCCCCTACCCTTTAGGGTTGTTAACCTCCTTGAACGAGC
AAACTACTAGAAAAATGCAGAAAGTCATGAAGGGCAAGCAACTGCAACTGCAACTGCAACTCTCAGTTTTCTCCATTATAAAAGAAGAGCAAGTCTCAAACTTATTCAACCAAACGTTTC
AGATTACAGAAAAGAGTAAGAGAGGTGGCGTTCGGAAGCAGTAGTTGTGACTGCGGCTCAAAGTTCCCACCACAGCATCAGGAAGAGCAGCCTGGCAAGGAATACTTGATGCACCCTTTG
CCTCAGCCACTCAACCCTGACTGCAAACCCTCCAACAAACTCCTT
GTAAGGCAACCTCAATAACTAGTTATGTGAGTTTATAACCAGTTATATGTGAAAAATAACTAGTTATAAGTGTTG
AATGGATGTACAGGGGAAGGTGGCTCTAGTGACAGGAGGAAACTCGGGGATAGGTAGATCGGTGTGTCTACACTTCGCAAATGGAAGGAGCGACCGTAGGATTCAGTTACGTCAAAGGAG
TAGAAGATATCGACAAGAATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCCTACACCAAGGTTGCTGTTGGGGCTGATTTAGTATCGCCCTCCCCCGATGTCGCCCTCCAGAAAGCTCGCACCTGGGACGAAGGCGTCTCTTCCAAATTCTCCACTACCCCTCTCAAA
GACATTTTCAAG
GGCAAGAAAGTTGTCATCTTTGGTCTTCCAGGTGCATACACAGGTGTTTGCTCGCAGCAGCATGTTCCTAGTTACAAGAACAACGCAGACAAGTTCAAGGCTAAAGGG
ATTGATTCGATCATTTGCGTGTCCGTTAACGACCCGTATGTGATGAATGGTTGGGCAGAGAAACTTCAAGCTAAAGATGAT
CTCGAATTCTACGGAGACTTTGATGGGAAGTTCCACAAG
AGCTTGGAGTTAACTAAGGATCTCTCTGGTGCTTTGCTTGGACCTCGCTCTGAAAG
ATTACAGAAAAGAGTAAGAGAGGTGGCGTTCGGAAGCAGTAGTTGTGACTGCGGCTCAAAGTTC
CCACCACAGCATCAGGAAGAGCAGCCTGGCAAGGAATACTTGATGCACCCTTTGCCTCAGCCACTCAACCCTGACTGCAAACCCTCCAACAAACTCCTT
GGGAAGGTGGCTCTAGTGACA
GGAGGAAACTCGGGGATAGGTAGATCGGTGTGTCTACACTTCGCAAATGGAAGGAGCGACCGTAGGATTCAGTTACGTCAAAGGAGTAGAAGATATCGACAAGAATGA

Retrieve as FASTA