Entry information : LuPrxQ185(Lus10033424|PACid:23172046)
Entry ID 12196
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrxQ185(Lus10033424|PACid:23172046)
Name LuPrxQ185(Lus10033424|PACid:23172046)
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrxQ185
start..stop
S start..stop
LuPrxQ190 407 3e-147 1..211 1..211
PtPrxQ01 317 1e-111 1..211 1..213
PbPrxQ01 316 2e-111 1..211 1..214
PtPrxQ02 305 4e-107 1..211 1..214
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1289281..1289469 189 N° 2 1289562..1289699 138 N° 3 1289773..1289862 90 N° 4 1289945..1290163 219
join(1289281..1289469,1289562..1289699,1289773..1289862,1289945..1290163)


exon

Literature and cross-references LuPrxQ185(Lus10033424|PACid:23172046)
DNA ref. Phytozome 11:   scaffold488 (1289281..1290163)
Protein sequence: LuPrxQ185(Lus10033424|PACid:23172046)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   212
PWM (Da):   %s   23407.2  
PI (pH):   %s   10.15
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASISLPKHCSICPTIWSPNKPIFPSSQHLPYNSQPKFNGLRFSNSVTAPRHLAFKPSIVAAKVNKGQVPPSFTLKDQDGKAVSLSKFKGKPVVLYFYPADESPSCTKQACAFRDSYEKFKKAGAEVVGISGDDSSSHKSFAKKYRLPFTLLSDEGNKVRKDWGVPSDLFGALPGRQTYVLDKKGVVQLIYNNQFQPEKHIDETLKLLQTL*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCATTTCGCTTCCGAAGCATTGTTCCATTTGTCCAACAATCTGGTCTCCTAATAAACCCATATTTCCATCTTCCCAACATCTACCATATAATTCTCAGCCCAAATTCAATGGC
CTCAGGTTCTCCAATTCCGTCACTGCACCTCGTCATCTCGCTTTCAAGCCCTCCATCGTCGCTGCGAAG
GTACATTCTTTATTGGGTTCTGGTCAGATGGGAAAATGGGATTTTTGTTGA
AGTTTCTTAATTTGGTATCTGTTTTGATGATATGAGTTCAGGTGAACAAAGGTCAGGTACCACCATCCTTCACATTGAAAGATCAAGATGGTAAGGCTGTAAGCCTCTCCAAGTTCAAGG
GCAAGCCTGTAGTTCTCTATTTCTATCCGGCTGATGAATCCCCTAGCTGCACTAAACAG
GTATTTCATTTCATTTCCCCTTCTGATCCTCAAACTAATGACACTGCATGCCCACTTAATG
ATTGTGTTGCAGGCTTGTGCTTTCAGGGATTCGTATGAGAAGTTTAAGAAAGCAGGAGCTGAGGTTGTTGGGATTAGTGGTGATGATTCATCGTCTCACAAGGTAATTAAACTGCAACCA
TTTCTTATTAGGAATATTTTGACCTGCTGTTCATTTAACTGTGGTGTGTGAATGTTTATTGTAGTCATTTGCTAAGAAGTATAGGCTGCCATTTACATTACTTAGCGACGAGGGTAACAA
AGTAAGGAAAGATTGGGGTGTCCCTTCTGATCTTTTTGGAGCATTGCCTGGGAGACAGACTTATGTTTTGGATAAGAAGGGAGTGGTTCAGCTCATCTATAATAACCAGTTCCAACCTGA
GAAGCACATTGATGAAACTCTCAAGCTACTTCAAACGCTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCATTTCGCTTCCGAAGCATTGTTCCATTTGTCCAACAATCTGGTCTCCTAATAAACCCATATTTCCATCTTCCCAACATCTACCATATAATTCTCAGCCCAAATTCAATGGC
CTCAGGTTCTCCAATTCCGTCACTGCACCTCGTCATCTCGCTTTCAAGCCCTCCATCGTCGCTGCGAAG
GTGAACAAAGGTCAGGTACCACCATCCTTCACATTGAAAGATCAAGATGGT
AAGGCTGTAAGCCTCTCCAAGTTCAAGGGCAAGCCTGTAGTTCTCTATTTCTATCCGGCTGATGAATCCCCTAGCTGCACTAAACAG
GCTTGTGCTTTCAGGGATTCGTATGAGAAGTTT
AAGAAAGCAGGAGCTGAGGTTGTTGGGATTAGTGGTGATGATTCATCGTCTCACAAG
TCATTTGCTAAGAAGTATAGGCTGCCATTTACATTACTTAGCGACGAGGGTAACAAAGTAAGG
AAAGATTGGGGTGTCCCTTCTGATCTTTTTGGAGCATTGCCTGGGAGACAGACTTATGTTTTGGATAAGAAGGGAGTGGTTCAGCTCATCTATAATAACCAGTTCCAACCTGAGAAGCAC
ATTGATGAAACTCTCAAGCTACTTCAAACGCTTTGA

Retrieve as FASTA