Entry information : LuPrxQ190(Lus10034892|PACid:23142269)
Entry ID 12197
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuPrxQ190(Lus10034892|PACid:23142269)
Name LuPrxQ190(Lus10034892|PACid:23142269)
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuPrxQ190
start..stop
S start..stop
LuPrxQ185 407 3e-147 1..211 1..211
PtPrxQ01 323 3e-114 1..211 1..213
PbPrxQ01 323 5e-114 1..211 1..214
EglPrxQ01 311 8e-109 1..210 56..267
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1493972..1494160 189 N° 2 1494308..1494445 138 N° 3 1494508..1494597 90 N° 4 1494685..1494903 219
join(1493972..1494160,1494308..1494445,1494508..1494597,1494685..1494903)


exon

Literature and cross-references LuPrxQ190(Lus10034892|PACid:23142269)
DNA ref. Phytozome 11:   scaffold66 (1493972..1494903)
Protein sequence: LuPrxQ190(Lus10034892|PACid:23142269)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   212
PWM (Da):   %s   23381.17  
PI (pH):   %s   10.21
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASISLPKHCSICPTIWSPNKPIHPSSQHLPTNSQPKFHGLVFSNSLTAPRRRAFMTSIVAAKVNKGQVPPSFTLKDQDGKAVSLNKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVVGISGDDSSSHKSFAKKYRLPFTLLSDEGNKVRKDWGVPSDLFGALPGRQTYVLDKKGVVQLIYNNQFQPEKHIDETLKLLQTL*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCATTTCGCTTCCGAAGCATTGTTCAATTTGTCCAACCATCTGGTCTCCTAATAAACCCATTCACCCATCTTCCCAACATCTACCAACAAATTCTCAGCCCAAATTCCATGGC
CTCGTCTTCTCCAACTCTCTCACTGCTCCTCGTCGTCGCGCTTTCATGACCTCCATTGTCGCTGCAAAG
GTACATTCTTTTTGGTCCTTCTGGTCGGATGGGAAAATGGCATTTTTATTC
AAGTTGCTTAATTTGGTTTTTTTGGGATGATATGGGAAAATTGCATTTTTGTGAAAGTTGCTTAATTTGGTATTTGTTTTGATGATATGGGTTCAGGTGAACAAAGGACAGGTACCACCA
TCCTTCACATTGAAAGATCAAGATGGTAAGGCTGTAAGCCTCAACAAGTTCAAGGGCAAGCCTGTAGTTGTCTATTTCTATCCGGCTGATGAAACCCCTGGCTGCACTAAACAG
GTATTT
TGATTGACCACTAATTATTGACACTGCATGCCCACTAATTAATGATTCTATTGCAGGCTTGTGCTTTCAGGGATTCGTATGAGAAGTTTAAGAAAGCAGGAGCTGAGGTTGTTGGGATTA
GTGGTGATGATTCATCGTCTCACAAG
GTAATTAAACTGCAACCATGCATTTCTTATTAGGAATACTTTGACCTGCTGTTCATTTAACTGTTTTTGAGTAAATGTTTGTTGCAGTCATTCG
CTAAGAAGTATAGGCTGCCATTTACATTACTTAGCGACGAGGGTAACAAAGTAAGGAAAGATTGGGGTGTCCCTTCTGATCTTTTTGGAGCATTGCCTGGGAGACAGACTTATGTTTTGG
ATAAGAAGGGAGTGGTTCAGCTCATCTATAATAACCAGTTCCAACCTGAGAAGCACATTGACGAAACTCTCAAGCTACTTCAAACGCTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCATTTCGCTTCCGAAGCATTGTTCAATTTGTCCAACCATCTGGTCTCCTAATAAACCCATTCACCCATCTTCCCAACATCTACCAACAAATTCTCAGCCCAAATTCCATGGC
CTCGTCTTCTCCAACTCTCTCACTGCTCCTCGTCGTCGCGCTTTCATGACCTCCATTGTCGCTGCAAAG
GTGAACAAAGGACAGGTACCACCATCCTTCACATTGAAAGATCAAGATGGT
AAGGCTGTAAGCCTCAACAAGTTCAAGGGCAAGCCTGTAGTTGTCTATTTCTATCCGGCTGATGAAACCCCTGGCTGCACTAAACAG
GCTTGTGCTTTCAGGGATTCGTATGAGAAGTTT
AAGAAAGCAGGAGCTGAGGTTGTTGGGATTAGTGGTGATGATTCATCGTCTCACAAG
TCATTCGCTAAGAAGTATAGGCTGCCATTTACATTACTTAGCGACGAGGGTAACAAAGTAAGG
AAAGATTGGGGTGTCCCTTCTGATCTTTTTGGAGCATTGCCTGGGAGACAGACTTATGTTTTGGATAAGAAGGGAGTGGTTCAGCTCATCTATAATAACCAGTTCCAACCTGAGAAGCAC
ATTGACGAAACTCTCAAGCTACTTCAAACGCTTTGA

Retrieve as FASTA