Entry information : LuRboh90(Lus10016740|PACid:23149147)
Entry ID 12207
Creation 2013-05-28 (Qiang Li)
Last sequence changes 2013-05-29 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2013-05-29 (Qiang LI)
Peroxidase information: LuRboh90(Lus10016740|PACid:23149147)
Name LuRboh90(Lus10016740|PACid:23149147)
Class Respiratory burst oxidase homolog    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuRboh90
start..stop
S start..stop
PtRboh06 857 0 1..517 4..516
PtRboh07 830 0 4..517 7..516
CsRboh05 804 0 11..517 14..532
CclRboh05 808 0 11..517 14..532
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 289112..289658 547 N° 2 288847..289006 160 N° 3 288710..288758 49 N° 4 288442..288555 114
N° 5 287652..288347 696  
complement(join(287652..288347,288442..288555,288710..288758,288847..289006,2891 12..289658))


exon

Literature and cross-references LuRboh90(Lus10016740|PACid:23149147)
DNA ref. Phytozome 11:   scaffold903 (289658..287652)
Protein sequence: LuRboh90(Lus10016740|PACid:23149147)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   521
PWM (Da):   %s   58527.2 Transmb domain:   %s   o349-368i433-452o487-509i
PI (pH):   %s   8.44
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTEEQHPPWETELVGVDRVPNSGPLSGPLNKKGGRKSARFNIPADQTSSSDQQYVEITLDLRDDSVAVHSVKASNGTEEDPEMTLLAKGLEKRSASNLGSSAMRSASARIRQVSQELRRLTSINKRPTGRLDRTKSAAAHALKGLKFISKADGGSGWVAVEKRFDEITDGMLPRSRFGECIGMKESKEFALELYDTLARKRNIQRDSITKSELKDFWDQISNQSFDSRLQTFFDMVDKDADGRITEEEVKIITLSASANKLSTIQKQAEEYAALIMEELDPEHHGYIMIESLEMLLLQGPSQSVRAADSKNLSKLLSQKLKPTLDENPISRWLRDAKYFLLDNWQRVWVMALWIGVMAGLFAYKYVQYRNRAAYEVMGACVCLAKGAAETLKLNMALILLPVCRNTITWLRNKTKLGLAVPFDDNLNFHKVIAVAITIGVGIHGISHLACDFPRLLDASDEKWELMEPFFGDQPSSYWHFVKSKEGVTGIVMVILMAIAFTLSTPWFRRNKLNLPLRSL*

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction. 3' end is missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTACAGAAGAACAGCATCCCCCATGGGAGACAGAGCTGGTGGGAGTTGACAGGGTACCCAACAGTGGGCCATTAAGCGGCCCTCTTAACAAAAAAGGTGGAAGAAAGAGCGCGAGG
TTCAACATACCTGCTGATCAGACTAGCTCGTCCGACCAGCAGTATGTTGAGATCACGCTCGATCTCAGAGACGACTCGGTGGCCGTTCACAGCGTTAAAGCTTCCAACGGCACAGAGGAA
GATCCCGAGATGACACTTCTAGCCAAAGGCTTGGAGAAGCGGTCGGCTTCCAATCTTGGTTCCTCTGCGATGAGAAGTGCTTCTGCTCGAATCCGTCAAGTTTCTCAAGAGCTGAGGCGG
CTCACTTCCATTAACAAAAGGCCCACGGGTCGGCTTGACAGGACCAAGTCGGCAGCGGCTCATGCTCTCAAGGGTCTCAAATTCATCAGTAAGGCCGACGGTGGTTCTGGATGGGTTGCT
GTGGAGAAGAGGTTCGATGAAATCACCGATGGGATGCTTCCTCGCTCTCGCTTTGGGGAATGCATTG
GTATGGCATGCATACCAACTGTCTGACAAGTTGTCACTAGTGAGGATTAAAGA
GATCCATGATCAACTTCTCAATTATTATGTATATCTTCTTAATCTGTGATAGGAATGAAGGAGTCAAAGGAATTCGCCTTGGAGTTGTATGATACTCTCGCTAGAAAGAGAAACATTCAG
AGGGATTCAATCACCAAGTCTGAGTTGAAGGACTTCTGGGATCAGATTTCCAACCAGAGCTTCGATTCCAGGCTCCAGACTTTCTTTGACAT
GTACTAAATTACCTCTTTGTGTCCCTTT
TGGTTAAATTGGGAACACAAAGTCAATGTTGGGTAATTTATATTGTGAAAATTATTTCAGGGTTGATAAAGATGCAGATGGTAGAATTACTGAAGAGGAAGTCAAGGAGGTATGTATGCG
CCATTGATCATTTTGAAGGGTTGACTTGACGACTAACGTGGTTTCTGGAGGGAATTGTGGCATGTGCTTGAGATGAGAGGAGGATTTGGTCTGAAGATTTCCCCTTTTTTTGTTTTAATT
CTAATTAATGAATATTTTTGCAGATCATTACCCTCAGTGCATCTGCAAACAAACTCTCGACTATCCAAAAACAAGCAGAGGAGTATGCTGCTTTGATTATGGAAGAATTGGATCCTGAAC
ACCATGGATACATCATG
GTAATGTAGAATTTGATTTCCTTAATAGCGCCATGCATATATAGTGTAGCAGTAGTGGTAGGTGTCCTGAATGGATCCGTTTGATTACAAACAGATAGAGAGC
TTGGAAATGCTGTTGCTGCAAGGACCAAGCCAGTCTGTGAGAGCAGCAGACAGCAAGAACCTGAGCAAACTGTTGAGCCAGAAGCTAAAGCCGACACTGGATGAGAACCCAATCAGTAGA
TGGTTGAGAGACGCGAAATACTTTTTGCTGGACAACTGGCAGAGAGTTTGGGTGATGGCTCTGTGGATTGGGGTAATGGCTGGCCTATTTGCTTATAAGTACGTGCAATATCGCAACAGA
GCTGCATACGAGGTCATGGGCGCTTGTGTCTGCCTAGCTAAAGGTGCTGCTGAAACACTCAAACTAAATATGGCTTTGATTCTGCTTCCTGTCTGCCGGAACACAATCACATGGCTCAGG
AATAAGACCAAACTAGGACTTGCTGTTCCTTTTGATGACAACCTCAACTTTCACAAGGTGATAGCGGTGGCAATAACAATTGGAGTAGGCATCCATGGCATATCCCATTTGGCCTGTGAC
TTCCCTCGTCTTCTAGATGCAAGCGATGAGAAATGGGAACTTATGGAGCCATTTTTTGGAGACCAGCCGTCGAGCTACTGGCATTTCGTTAAGTCAAAGGAAGGGGTTACTGGGATTGTG
ATGGTTATTCTGATGGCGATAGCTTTCACACTTTCCACTCCTTGGTTCAGGCGAAACAAGCTCAATTTGCCACTGCGGAGCCTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTACAGAAGAACAGCATCCCCCATGGGAGACAGAGCTGGTGGGAGTTGACAGGGTACCCAACAGTGGGCCATTAAGCGGCCCTCTTAACAAAAAAGGTGGAAGAAAGAGCGCGAGG
TTCAACATACCTGCTGATCAGACTAGCTCGTCCGACCAGCAGTATGTTGAGATCACGCTCGATCTCAGAGACGACTCGGTGGCCGTTCACAGCGTTAAAGCTTCCAACGGCACAGAGGAA
GATCCCGAGATGACACTTCTAGCCAAAGGCTTGGAGAAGCGGTCGGCTTCCAATCTTGGTTCCTCTGCGATGAGAAGTGCTTCTGCTCGAATCCGTCAAGTTTCTCAAGAGCTGAGGCGG
CTCACTTCCATTAACAAAAGGCCCACGGGTCGGCTTGACAGGACCAAGTCGGCAGCGGCTCATGCTCTCAAGGGTCTCAAATTCATCAGTAAGGCCGACGGTGGTTCTGGATGGGTTGCT
GTGGAGAAGAGGTTCGATGAAATCACCGATGGGATGCTTCCTCGCTCTCGCTTTGGGGAATGCATTG
GAATGAAGGAGTCAAAGGAATTCGCCTTGGAGTTGTATGATACTCTCGCTAGA
AAGAGAAACATTCAGAGGGATTCAATCACCAAGTCTGAGTTGAAGGACTTCTGGGATCAGATTTCCAACCAGAGCTTCGATTCCAGGCTCCAGACTTTCTTTGACAT
GGTTGATAAAGAT
GCAGATGGTAGAATTACTGAAGAGGAAGTCAAGGAG
ATCATTACCCTCAGTGCATCTGCAAACAAACTCTCGACTATCCAAAAACAAGCAGAGGAGTATGCTGCTTTGATTATGGAAGAA
TTGGATCCTGAACACCATGGATACATCATG
ATAGAGAGCTTGGAAATGCTGTTGCTGCAAGGACCAAGCCAGTCTGTGAGAGCAGCAGACAGCAAGAACCTGAGCAAACTGTTGAGCCAG
AAGCTAAAGCCGACACTGGATGAGAACCCAATCAGTAGATGGTTGAGAGACGCGAAATACTTTTTGCTGGACAACTGGCAGAGAGTTTGGGTGATGGCTCTGTGGATTGGGGTAATGGCT
GGCCTATTTGCTTATAAGTACGTGCAATATCGCAACAGAGCTGCATACGAGGTCATGGGCGCTTGTGTCTGCCTAGCTAAAGGTGCTGCTGAAACACTCAAACTAAATATGGCTTTGATT
CTGCTTCCTGTCTGCCGGAACACAATCACATGGCTCAGGAATAAGACCAAACTAGGACTTGCTGTTCCTTTTGATGACAACCTCAACTTTCACAAGGTGATAGCGGTGGCAATAACAATT
GGAGTAGGCATCCATGGCATATCCCATTTGGCCTGTGACTTCCCTCGTCTTCTAGATGCAAGCGATGAGAAATGGGAACTTATGGAGCCATTTTTTGGAGACCAGCCGTCGAGCTACTGG
CATTTCGTTAAGTCAAAGGAAGGGGTTACTGGGATTGTGATGGTTATTCTGATGGCGATAGCTTTCACACTTTCCACTCCTTGGTTCAGGCGAAACAAGCTCAATTTGCCACTGCGGAGC
CTTTAA

Retrieve as FASTA