Entry information : LfluCIIAA02
Entry ID 12223
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: LfluCIIAA02
Name LfluCIIAA02
Class Asco Class II type A    [Orthogroup: CIIAA001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Lentitheciaceae Lentithecium
Organism Lentithecium fluviatile    [TaxId: 690899 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LfluCIIAA02
start..stop
S start..stop
ClunCIIAA01 337 4e-114 1..378 24..402
ManiCIIAA01 331 4e-112 12..356 29..370
CheCIIAA05_C5 330 1e-111 1..358 24..379
CheCIIAA05_C4 330 1e-111 1..358 24..379
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 73133..74059 927 N° 2 74120..74332 213  
join(73133..74059,74120..74332)


exon

Literature and cross-references LfluCIIAA02
DNA ref. JGI genome:   scaffold_6 (73133..74332)
Cluster/Prediction ref. JGI gene:   360106
Protein sequence: LfluCIIAA02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   380
PWM (Da):   %s   41435.58  
PI (pH):   %s   4.58
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSRTLSHPAFLSKRDPETPELLADLKTLPDAELTRVGALIKSILLLENATAPFTQNLTYVYTAPGPLASPECRADTCCVWSYVAEEMERDFRGPTGRCNEFARQAIRLGFHDAGTWSKSEGGSGADGSFVLGGEIARPINRGLEEINNKMWAYYHTFHSYGAGMADLVQMGATVAAAVCPQGPRILSFVGRNDSDVPAPEGRLPQATQDAEPLIALFEDKTIDRGDLITLLGAHTIGQQRFEDTARAGDPQSSTPGVWSTDFYRETPRNDTPKRVFKFHSDVEIATFEESLPLWGVFADPVNGLETWNSGYAAVYIRLSVLGVPHINNLVECTGVLPLPVRNYSAPDGAELSEWLNSDRAPMREEAILLMNGESLKGEV*

Retrieve as FASTA  
Remarks complete sequence from genomics (1 intron)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCCGCACACTATCCCACCCGGCATTCCTCTCGAAACGAGACCCCGAGACACCCGAACTCCTCGCAGACCTCAAGACCCTCCCAGACGCAGAACTCACCCGTGTCGGCGCACTCATA
AAGTCCATCCTCCTGCTCGAGAACGCCACCGCACCCTTTACCCAGAATCTCACCTACGTATACACGGCTCCCGGCCCTCTCGCGAGCCCCGAATGCCGCGCCGACACATGCTGCGTGTGG
TCGTACGTCGCTGAGGAGATGGAACGGGACTTTAGGGGGCCAACGGGTCGTTGCAACGAGTTTGCGCGGCAGGCGATCCGGCTGGGCTTCCACGATGCGGGGACCTGGTCGAAGAGCGAG
GGCGGCAGCGGCGCGGACGGCTCGTTCGTGCTCGGGGGGGAGATCGCGCGGCCCATCAACCGCGGGCTCGAGGAGATCAACAACAAGATGTGGGCGTACTACCACACCTTCCACTCGTAC
GGCGCCGGCATGGCCGACCTCGTACAAATGGGTGCAACTGTAGCTGCGGCGGTTTGTCCCCAAGGCCCGCGCATTCTGTCCTTTGTAGGCCGCAACGACAGCGACGTTCCTGCGCCCGAG
GGCAGACTGCCACAAGCGACTCAGGATGCGGAGCCTTTGATTGCGCTGTTCGAAGATAAGACGATCGATAGGGGGGATCTGATTACGCTGCTTGGGGCGCATACAATCGGCCAGCAGCGC
TTCGAGGACACGGCGCGAGCGGGCGATCCGCAGAGTTCGACGCCGGGAGTGTGGAGCACGGATTTCTATCGCGAGACGCCGCGCAACGACACGCCGAAACGGGTGTTCAAGTTCCATAGC
GACGTGGAGATTGCGACATTTGAAGAGTCATTGCCGCTTTGGGGGGTGTTTGCGGATCCGGTGAATGGCCTTGAGACTTGGAATTCT
GTGAGTCCTCCAGGTGTACGCGCCTATCTTCTT
GAGAGTGTGTGAGCTGATTGGGATAAGGGATATGCCGCGGTGTATATCCGCCTCAGTGTCCTCGGCGTTCCGCACATAAATAACTTGGTCGAATGTACGGGGGTTTTGCCGTTGCCTGTA
AGAAATTATTCGGCGCCTGATGGGGCAGAGTTGAGCGAGTGGCTGAACAGTGATCGCGCTCCTATGCGCGAAGAAGCGATTCTATTGATGAACGGGGAGTCTTTGAAGGGGGAGGTCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCCGCACACTATCCCACCCGGCATTCCTCTCGAAACGAGACCCCGAGACACCCGAACTCCTCGCAGACCTCAAGACCCTCCCAGACGCAGAACTCACCCGTGTCGGCGCACTCATA
AAGTCCATCCTCCTGCTCGAGAACGCCACCGCACCCTTTACCCAGAATCTCACCTACGTATACACGGCTCCCGGCCCTCTCGCGAGCCCCGAATGCCGCGCCGACACATGCTGCGTGTGG
TCGTACGTCGCTGAGGAGATGGAACGGGACTTTAGGGGGCCAACGGGTCGTTGCAACGAGTTTGCGCGGCAGGCGATCCGGCTGGGCTTCCACGATGCGGGGACCTGGTCGAAGAGCGAG
GGCGGCAGCGGCGCGGACGGCTCGTTCGTGCTCGGGGGGGAGATCGCGCGGCCCATCAACCGCGGGCTCGAGGAGATCAACAACAAGATGTGGGCGTACTACCACACCTTCCACTCGTAC
GGCGCCGGCATGGCCGACCTCGTACAAATGGGTGCAACTGTAGCTGCGGCGGTTTGTCCCCAAGGCCCGCGCATTCTGTCCTTTGTAGGCCGCAACGACAGCGACGTTCCTGCGCCCGAG
GGCAGACTGCCACAAGCGACTCAGGATGCGGAGCCTTTGATTGCGCTGTTCGAAGATAAGACGATCGATAGGGGGGATCTGATTACGCTGCTTGGGGCGCATACAATCGGCCAGCAGCGC
TTCGAGGACACGGCGCGAGCGGGCGATCCGCAGAGTTCGACGCCGGGAGTGTGGAGCACGGATTTCTATCGCGAGACGCCGCGCAACGACACGCCGAAACGGGTGTTCAAGTTCCATAGC
GACGTGGAGATTGCGACATTTGAAGAGTCATTGCCGCTTTGGGGGGTGTTTGCGGATCCGGTGAATGGCCTTGAGACTTGGAATTCT
GGATATGCCGCGGTGTATATCCGCCTCAGTGTC
CTCGGCGTTCCGCACATAAATAACTTGGTCGAATGTACGGGGGTTTTGCCGTTGCCTGTAAGAAATTATTCGGCGCCTGATGGGGCAGAGTTGAGCGAGTGGCTGAACAGTGATCGCGCT
CCTATGCGCGAAGAAGCGATTCTATTGATGAACGGGGAGTCTTTGAAGGGGGAGGTCTAG

Retrieve as FASTA