Entry information : LfluCcP01
Entry ID 12224
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: LfluCcP01
Name LfluCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Lentitheciaceae Lentithecium
Organism Lentithecium fluviatile    [TaxId: 690899 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LfluCcP01
start..stop
S start..stop
Ssrc1lsm3aCcP01 632 0 1..379 1..374
AalteCcP01 626 0 1..379 1..374
PtritCcP 623 0 1..379 1..374
AbraCcP 622 0 1..379 1..373
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2213526..2213953 428 N° 2 2212757..2213468 712  
complement(join(2212757..2213468,2213526..2213953))


exon

Literature and cross-references LfluCcP01
DNA ref. JGI genome:   scaffold_1 (2213953..2212757)
Cluster/Prediction ref. JGI gene:   354328
Protein sequence: LfluCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   380
PWM (Da):   %s   42812.21  
PI (pH):   %s   9.07
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASASRTLTRALRTASTPTFRTTSRTTSRTTRFVAPQQAFRQQYQRRGFASREDHPDKYEGNPSGMLWGAGALIAVAGGYGLYTQKPEWFGQEPKAKGVFAPKFEDYQKVYDHIAKLLEEKDDYDDGSYGPVLLRLAWHASGTYDKETGTGGSNGATMRFAPEGDHGANAGLKAARDFLEPVKAHFPWLSYSDLWILAGVCAIQEMQGPKIPYRPGRADRDLSFCTPDGRLPDASKGASHIRAIFGRMGFNDQQMVALSGAHALGRCHTDRSGYEGPWTFSPTTLTNDYYKLLLEEKWAWKKWNGPKQYEDVKTKSLMMLPTDMELIKDRSFRKYVEKYAKDNEAFFKDFSEAVVQLFELGVPFVQGEEQRWVFRSSFD

Retrieve as FASTA  
Remarks complete sequence from genomics (1 intron)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCCGCCTCTCGAACCCTCACCCGCGCCCTGCGCACCGCATCCACACCCACCTTCCGCACCACCTCTCGCACCACCTCCCGCACCACCCGCTTCGTCGCTCCCCAGCAAGCCTTC
CGCCAGCAGTACCAACGCCGCGGCTTCGCCTCCAGGGAGGACCACCCAGACAAGTATGAGGGCAACCCCAGCGGCATGCTCTGGGGCGCCGGCGCGCTGATCGCCGTCGCTGGCGGCTAC
GGCCTGTACACGCAGAAGCCGGAGTGGTTCGGCCAGGAACCCAAGGCCAAGGGCGTGTTCGCGCCCAAGTTCGAGGACTACCAGAAGGTTTACGACCACATTGCGAAGCTGCTCGAGGAG
AAGGACGACTACGATGACGGGAGCTACGGACCGGTCTTGCTCCGGTTGGCATGGCATGCGTCTGGGAC
GTGAGTATTCCCATCAGACCACCACGCAAGCAACGCAATTGCTAACAGAGTC
CGCAGCTACGACAAAGAAACCGGCACGGGCGGCTCCAACGGCGCAACCATGCGCTTCGCGCCCGAAGGCGACCACGGCGCCAACGCGGGCCTCAAAGCCGCGCGCGACTTCCTCGAGCCC
GTCAAAGCCCACTTCCCCTGGCTCTCATACTCCGACCTCTGGATCCTCGCCGGTGTGTGCGCCATCCAGGAAATGCAGGGCCCCAAGATCCCCTACCGCCCTGGCCGCGCAGACCGCGAC
CTCTCCTTCTGCACGCCCGACGGCCGCCTCCCCGACGCGAGCAAGGGCGCCTCGCACATCCGCGCCATCTTCGGCCGCATGGGCTTCAACGACCAGCAGATGGTTGCGTTGTCCGGTGCA
CACGCGCTCGGCCGGTGTCATACCGATCGCTCCGGGTACGAGGGCCCGTGGACGTTCAGTCCTACCACCCTGACCAACGACTACTACAAGCTGCTGCTTGAGGAGAAGTGGGCGTGGAAG
AAGTGGAATGGGCCGAAGCAGTATGAGGATGTCAAGACGAAGAGTCTTATGATGCTGCCGACGGATATGGAGCTTATCAAGGATAGGAGCTTTAGGAAATATGTGGAGAAGTATGCCAAG
GATAACGAGGCATTTTTCAAGGACTTTTCTGAGGCGGTGGTGCAGCTTTTTGAGCTCGGCGTGCCGTTTGTGCAGGGCGAGGAGCAGCGGTGGGTGTTTAGGAGCTCGTTTGATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCCGCCTCTCGAACCCTCACCCGCGCCCTGCGCACCGCATCCACACCCACCTTCCGCACCACCTCTCGCACCACCTCCCGCACCACCCGCTTCGTCGCTCCCCAGCAAGCCTTC
CGCCAGCAGTACCAACGCCGCGGCTTCGCCTCCAGGGAGGACCACCCAGACAAGTATGAGGGCAACCCCAGCGGCATGCTCTGGGGCGCCGGCGCGCTGATCGCCGTCGCTGGCGGCTAC
GGCCTGTACACGCAGAAGCCGGAGTGGTTCGGCCAGGAACCCAAGGCCAAGGGCGTGTTCGCGCCCAAGTTCGAGGACTACCAGAAGGTTTACGACCACATTGCGAAGCTGCTCGAGGAG
AAGGACGACTACGATGACGGGAGCTACGGACCGGTCTTGCTCCGGTTGGCATGGCATGCGTCTGGGAC
CTACGACAAAGAAACCGGCACGGGCGGCTCCAACGGCGCAACCATGCGCTTC
GCGCCCGAAGGCGACCACGGCGCCAACGCGGGCCTCAAAGCCGCGCGCGACTTCCTCGAGCCCGTCAAAGCCCACTTCCCCTGGCTCTCATACTCCGACCTCTGGATCCTCGCCGGTGTG
TGCGCCATCCAGGAAATGCAGGGCCCCAAGATCCCCTACCGCCCTGGCCGCGCAGACCGCGACCTCTCCTTCTGCACGCCCGACGGCCGCCTCCCCGACGCGAGCAAGGGCGCCTCGCAC
ATCCGCGCCATCTTCGGCCGCATGGGCTTCAACGACCAGCAGATGGTTGCGTTGTCCGGTGCACACGCGCTCGGCCGGTGTCATACCGATCGCTCCGGGTACGAGGGCCCGTGGACGTTC
AGTCCTACCACCCTGACCAACGACTACTACAAGCTGCTGCTTGAGGAGAAGTGGGCGTGGAAGAAGTGGAATGGGCCGAAGCAGTATGAGGATGTCAAGACGAAGAGTCTTATGATGCTG
CCGACGGATATGGAGCTTATCAAGGATAGGAGCTTTAGGAAATATGTGGAGAAGTATGCCAAGGATAACGAGGCATTTTTCAAGGACTTTTCTGAGGCGGTGGTGCAGCTTTTTGAGCTC
GGCGTGCCGTTTGTGCAGGGCGAGGAGCAGCGGTGGGTGTTTAGGAGCTCGTTTGATTGA

Retrieve as FASTA