Entry information : LuRboh[P]218
Entry ID 12230
Creation 2013-05-29 (Qiang LI)
Last sequence changes 2013-05-30 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang Li)
Peroxidase information: LuRboh[P]218
Name LuRboh[P]218
Class Respiratory burst oxidase homolog    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuRboh[P]218
start..stop
S start..stop
PtRboh06 1054 0 13..631 129..909
LuRboh[P]232 1033 0 1..631 11..637
PtRboh07 1023 0 13..631 129..909
CclRboh05 1007 0 14..631 144..929
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 708330..708368 39 N° 2 708564..708665 102 N° 3 708898..709029 132 N° 4 709124..709237 114
N° 5 709640..710005 366 N° 6 710627..710709 83 N° 7 710764..711010 247 N° 8 711273..711485 213
N° 9 712372..712508 137 N° 10 712534..712566 33 N° 11 712620..712936 317 N° 12 713155..713264 110
join(708330..708368,708564..708665,708898..709029,709124..709237,709640..710005, 710627..710709,710764..711010,711273..711485,712372..712508,712534..712566,71262 0..712936,713155..713264)


exon

Literature and cross-references LuRboh[P]218
DNA ref. Phytozome 11:   scaffold25 (708330..713264)
Protein sequence: LuRboh[P]218
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   631
PWM (Da):   %s   71811.9 Transmb domain:   %s   o165-187i247-269o289-311i332-354o
PI (pH):   %s   8.93
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
YVEITLDLRDDSVDRTKSAAAPALKGLKFISKADGGSGWVAVEKRFDISKFELKDFWDQISDQSFDSRLQTFFDMVDKDADGRITEEEVKEIITLSASANRLSNIQKQAEEYAALIMEELDPEHHGYIMSKNLSKLLSQKLKPTLDENPISRWLRNTKYFLLDNWQRVWVMALWMGVMAGLFAYKYIQYRDRSAYEVMGVCVCLAKGGAETLKLNMALILLPVCRNTITWLRNKTKLGVAVPFDDNLNFHKVIAVAITIGVGIHAIAHLACDFPRLLAAYWHFVKSKEGVTGIIMVVLMAIAFTLATPWFRRNKLXNLPPFLKKLTGFNAFWYSHHLFVIVYTLLVVHGYYLYLTKEWYK*VAIYPGNVLALHMSKPNGFRYKSGQYMFVNCAAVSPFEWHPFSITSAPGDDYLSIHIRTLGDWTRQLRTVLIDGPYGAPAQDYKEYEVVLLVGLGIGATPMISILKDIVNNMKDEESWRTEGGPRGGKDAFNTRRAYFYWVTREQGSFDWFKGVMNEVAEVDRNHVIELHNYCTSVYEEGDARSALIAMLQSLHHAKNGLDIVSGTRVKSHFAKPNWRTVFKQVAVHHPNSAGVFYCGAPGLTKELRNLALDFSHKTTTKFEFHKEN

Retrieve as FASTA  
Remarks Pseudogene from genomic. No prediction. Some PS are missing. join(708330..708368,708564..708665,708898..709029,709124..709234,709637..710005,710627..710710,710765..711010,711273..711485,712372..712508,712534..712566,712620..712936,713155..713264)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TACGTCGAGATCACCCTCGACCTCAGGGACGATTCCGTCGCCCTCCACAGCGTCAAAGCCGCCAACGGCGCAGACGAGGATCCGGAGATGACGCTCCTCGCCAAGGACCTCGAGAAGCGG
ACGGCTTCCAACATAGGCTCCTCCGTGGTCCGAACTGCCTCGGCTAAGATCCGTCAAGTTTCTCAAGAGCTCAGGCGGCTCACTTCCGTCAACAGAAGACCGACGGGTAGACTTGACCGT
ACAAAGTCAGCGGCGGCTCCTGCTCTGAAAGGTCTCAAGTTCATCAGCAAGGCCGACGGCGGCTCCGGATGGGTTGCCGTGGAAAAGAGGTTCGAC
CAGATCACTGCTGATTCCCCGGAC
GGGATGCTTCCCCGTGCTCGCTTCGGAGAATGTATAGGTGTGTATGCAGCCAAACTGTTGAGAATTTGCCTGAGAGAGAGGAGATGGTTTCTGCATTCTGAAAGCTTTTTTTGGTATGTG
ATGATTGGCAGGGATGAAGGAGTCCAAGGAATTTGCGTTGGAGTTGTATGATGCTCTGGCGAGGAAGAGAAACATTCAGAGGGATTCGATCAGCAAGTTTGAGCTAAAGGACTTCTGGGA
TCAGATCTCTGATCAGAGCTTTGATTCTAGGCTCCAGACTTTCTTTGACATGGTTGATAAAGATGCAGATGGCAGAATTACTGAAGAGGAAGTCAAGGAG
GTATGTCTGACTTTATAACC
CAACCATAAGAGTTTGAAGATTTCATTTCTTTTGTTAATAATCTCTCAAAAGTAATGACTACTTTTTTATGCAGATCATCACCCTCAGTGCTTCTGCAAACAGACTCTCGAATATCCAGA
AACAAGCAGAGGAGTATGCAGCTTTGATCATGGAAGAATTGGACCCAGAGCACCATGGATACATCATG
GTAAAACTCAAAACCTGGAATTCGTTGTACTTAAAAAGGCGTGTTTGGCAAT
AATAATCATGATTTTTACGAAAATTGAATTAAAACTAACGAAAAAAATTGATTTGAGATTGGAAGAAATTGTCAACGAAAGTATAAAGGATTTTTAACAGAATTTATTTTTCCTTTTGAA
TAAATTGGAAAATTCTATTTGGAATCCTTATCTCTTAATCCAAATTCTTTCTACAATCTCAATGTCAACTCTTTTGTTTCTAAAGATTATAATTTTTGTTGCCAAACCAATCCTAAATAT
AGATAGGTTTGTAATTTACCATTTTTTTCCTTATGTTATGATGCAAACAGATAGAGAACCTAGAAATGCTATTGCTGCAAGGACCAAACCAGTCAGTGAGAGCAGGAGAGAGCAAGAACT
TGAGCAAGCTGCTGAGCCAGAAGCTGAAGCCGACGCTGGATGAGAACCCAATAAGTAGATGGCTAAGAAACACAAAGTACTTCCTGTTGGATAACTGGCAGAGAGTTTGGGTGATGGCTT
TGTGGATGGGAGTTATGGCTGGTCTGTTTGCTTACAAGTATATCCAGTACCGTGACAGGTCTGCATATGAGGTCATGGGGGTATGTGTATGCTTGGCCAAAGGTGGAGCCGAGACTCTGA
AACTAAACATGGCTTTGATTTTGCTCCCCGTTTGCCGGAACACCATTACCTGGCTCCGCAACAAGACCAAGCTAGGTGTTGCCGTTCCTTTTGACGACAACCTTAACTTCCACAAG
GTGA
TAATAAAAAAATGTGCTTATGTTTTTTTCTCTTATTTGCTACTAGGGTGTTCAAGCCGCTAAAAAAAAAGCTCGTTCATGACTCGGTTCAATTTTAAATGAGCCAAACTTGAGATAGGGT
ATGTTTGACTTGTTAACCTTGCTAGAGCTCGAGCTCTAGAGCCAACTCGAATACTAGCTCGAGTATATGACTCGTTAGTAGACTCAATAATGCAACGTGTTTTTGCGTTGAATACCATAT
ACAATAAATCATATGTGATTTTTTATTGTGTTAACGAAAATGCAAGTGGATATGTTGTCTAGTTTTAATTACTTTATTTGAGAAAAGTAGAAACTTGTAAATTTTAGGATAGCTTGTTTT
ATAGCTTTTACTCATCAATGTGTTCTAGTGTACAAACTTGAATTTCTACTGAAATTGGACTAGGTTTTAATGAGCAAAGTTCAAGTTGAGCTCGAGTTTGGCTCGTCAAGACTAGTTAAC
GAGTCAGGCTCTAGCTCGAGACGAGCTAAAATTTTATAGCTCGAGCATAGTGAAATTTGGCTTGCTAGGTTCGTGAACAGCCCCATTTACTACCCTAGCCTTAGTAGCTGACAGTTTCTA
CCGTCTAATTTTCAAAGGTGATAGCAGTGGCGATAACAATAGGAGTAGGGATCCACGCCATAGCCCATCTGGCATGCGACTTCCCTCGCCTTCTCGCTGCGGATGAAGAGAAATGGGAAC
TTATGCAGCCATTCTTCGGAGATCAACCTTCGAGCTACTGGCATTTCGTCAAGTCGAAAGAAGGGGTGACTGGGATTATTATGGTCGTTCTCATGGCAATAGCCTTCACACTTGCCACTC
CTTGGTTCAGGCGCAACAAGCTCNNNAACTTGCCACCTTTCCTGAAGAAGCTCACCGGTTTCAATGCCTTCTGGTACTCTCACCATTTGTTTGTCATCGTCTACACTTTGCTTGTTGTCC
ACGGTTACTACCTGTACCTTACCAAGGAGTGGTACAAGAAG
ACTGTAAGTTAATCCCTTTTTCTCCCCCTCCGTGCCTTGCGATGTTGTAATCAAAACCTGACCTGTTTTATTGTTGGAA
TGACAGACATGGATGTACCTGGCAGTTCCAGTAGTGCTTTACGCCAGTGAGAGGTTGACAAGGGCACTTAGATCCAGCATCAAGGCAGTTACAATCAAGAAGGTAATAGTATGATTTTGA
TTCAAGCCAGTCCAGTCCTTTTCTTTGTGTATGGGGCTTTTCTGAGACATGATGAATGATGGTTAGGTGGCCATTTATCCTGGAAATGTGTTGGCACTTCACATGTCAAAGCCTAATGGG
TTCAGATACAAGAGCGGGCAGTACATGTTTGTGAATTGTGCAGCTGTGTCTCCATTTGAATGGCACCCGTTCTCCATAACTTCAGCTCCTGGAGACGATTACTTGAGTATTCATATTAGA
ACCCTTGGAGATTGGACAAGGCAGCTGAGAACTGTC
TTCCAGGAGGTACAAAAGATTACCCTTCCTGCTTTTTGTTATACTGTATCCAAGTAAAATGTTGATGATAATCAAGATGCCATT
TTCCAAATGGTTTTTGTCTTGGTATAGGTGTGTCAGCCACCAACAACAGGGAAGAGTGGACTCCTCAGAGCCGATGAATTTCAGGGGAATAACAATCCCGAGTAAGTACTCTTTTCTTTT
GGGGAAAATAGGGGAAGTTGATGATGTAATAAACAACGAGGAAAGCTAGAAACCAAAAACTACTCACATGCGTACTACTGATCTCATTGTTAGTTGGCATATCAAAAGAGAGAATATATA
TTCATCACAGTCCAAAGTGCATATGATAAGCCTTACAAAAAAGCTGTCGTCCTTTCTAGCCGGTATAAGCGTAAACAATGTTTAGGCGATCTAATAGTTTTTTAGAGTATTATAAACCCT
TTTCCAAATTTTCTAATAGAAAGTTTATCAACTAGTCTCATGACCACCATGTTCAGCAGCCAACAAGAGTGGCTGCTGATGAAAAAGTAAAGTAATGGCCAATGGAACATTATTATGCAG
AATAGCAGACCCTATACCCCACCGCACCAAACATGAGAAGCGAGTGTCGTTTGTTAGCTTTGAATAATGACAAAATATTAGATAAGACCAGTTGACGATAAGTGAAGTTCTTAGTTAAGG
ATGTTTTGGATGAAGTATTTTATTTTGAGAGTAAATTAATTGAAATATCATAGTGGTAACTTAAAATGAGTTATTTAAAATGTCACAATTTTATAATTTTATAATTTTTTTTCGAATTGT
CAAGAAAATAACCTATAACTCCCACAATTAGGAAACTGATGATGGTTGGTGGTAACTTGTGATTGGCAGCTTCCCGAGGATACTGATAGACGGACCATACGGAGCACCAGCGCAAGACTA
CAAGGAATACGAGGTGGTACTGCTGGTGGGTCTTGGAATCGGAGCAACTCCGATGATCAGCATCCTCAAGGACATTGTGAACAACATGAAGGACGAGGA
AGAAGGGGTGAATAATAACGA
CAATGAGTTGGAGAACGGAGGGAGGTCCCCGAGGAGGCAGTCTCCGATCAGCCACCACAGTAATAATAATAATGCATCGAGCAGCAAGAGGAAGGACGCGTTCAACACGAGGAGGGCCTA
TTTCTACTGGGTCACAAGGGAACAAGGCTCATTCGACTGGTTCAAAGGTGTCATGAATGAGGTCGCAGAGGTGGACCGAAACCACGTCATCGAGCTCCATAACTACTGTACGAGTGTCTA
TGAAGAAGGTGATGCCCGTTCTGCACTCATCGCCATGCTCCAGTCCCTTCATCACGCCAAGAATGGCCTGGACATTGTATCCGGAACACGTGTCAAGTCCCACTTTGCCAAGCCTAATTG
GCGTACAGTGTTCAAGCAAGTCGCTGTTCACCACCCTAATTCTCGAG
TTGGTACGTATATACACTGTCGCTCCCTCTTTAATATTTTGTTTAGATATCATGGATTATATCTGAATTATTT
CTCAATAACTCATTATCGTGATATAATTAGATGGTTGTTCTTAATTTCTTTAAATCTTGTAGTTCTGAATAAACACATTTTGTTTGCTGATAGAATAGAATCTAATAGAGTTTGAAACTG
ATGTGGAGTGTTGCTGTTTTGTTGGCAGGTGTGTTTTACTGTGGGGCACCGGGATTGACGAAGGAGCTGCGAAACTTAGCTCTGGATTTCTCACACAAGACCACCACCAAGTTTGAATTC
CACAAAGAGAACTTC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TACGTCGAGATCACCCTCGACCTCAGGGACGATTCCGTCGACCGTACAAAGTCAGCGGCGGCTCCTGCTCTGAAAGGTCTCAAGTTCATCAGCAAGGCCGACGGCGGCTCCGGATGGGTT
GCCGTGGAAAAGAGGTTCGAC
ATCAGCAAGTTTGAGCTAAAGGACTTCTGGGATCAGATCTCTGATCAGAGCTTTGATTCTAGGCTCCAGACTTTCTTTGACATGGTTGATAAAGATGCA
GATGGCAGAATTACTGAAGAGGAAGTCAAGGAG
ATCATCACCCTCAGTGCTTCTGCAAACAGACTCTCGAATATCCAGAAACAAGCAGAGGAGTATGCAGCTTTGATCATGGAAGAATTG
GACCCAGAGCACCATGGATACATCATG
AGCAAGAACTTGAGCAAGCTGCTGAGCCAGAAGCTGAAGCCGACGCTGGATGAGAACCCAATAAGTAGATGGCTAAGAAACACAAAGTACTTC
CTGTTGGATAACTGGCAGAGAGTTTGGGTGATGGCTTTGTGGATGGGAGTTATGGCTGGTCTGTTTGCTTACAAGTATATCCAGTACCGTGACAGGTCTGCATATGAGGTCATGGGGGTA
TGTGTATGCTTGGCCAAAGGTGGAGCCGAGACTCTGAAACTAAACATGGCTTTGATTTTGCTCCCCGTTTGCCGGAACACCATTACCTGGCTCCGCAACAAGACCAAGCTAGGTGTTGCC
GTTCCTTTTGACGACAACCTTAACTTCCACAAG
GTGATAGCAGTGGCGATAACAATAGGAGTAGGGATCCACGCCATAGCCCATCTGGCATGCGACTTCCCTCGCCTTCTCGCTGCCTAC
TGGCATTTCGTCAAGTCGAAAGAAGGGGTGACTGGGATTATTATGGTCGTTCTCATGGCAATAGCCTTCACACTTGCCACTCCTTGGTTCAGGCGCAACAAGCTCNNNAACTTGCCACCT
TTCCTGAAGAAGCTCACCGGTTTCAATGCCTTCTGGTACTCTCACCATTTGTTTGTCATCGTCTACACTTTGCTTGTTGTCCACGGTTACTACCTGTACCTTACCAAGGAGTGGTACAAG
AAG
TAGGTGGCCATTTATCCTGGAAATGTGTTGGCACTTCACATGTCAAAGCCTAATGGGTTCAGATACAAGAGCGGGCAGTACATGTTTGTGAATTGTGCAGCTGTGTCTCCATTTGAA
TGGCACCCGTTCTCCATAACTTCAGCTCCTGGAGACGATTACTTGAGTATTCATATTAGAACCCTTGGAGATTGGACAAGGCAGCTGAGAACTGTC
CTGATAGACGGACCATACGGAGCA
CCAGCGCAAGACTACAAGGAATACGAGGTGGTACTGCTGGTGGGTCTTGGAATCGGAGCAACTCCGATGATCAGCATCCTCAAGGACATTGTGAACAACATGAAGGACGAGGA
GAGTTGG
AGAACGGAGGGAGGTCCCCGAGGAGG
GAAGGACGCGTTCAACACGAGGAGGGCCTATTTCTACTGGGTCACAAGGGAACAAGGCTCATTCGACTGGTTCAAAGGTGTCATGAATGAGGTC
GCAGAGGTGGACCGAAACCACGTCATCGAGCTCCATAACTACTGTACGAGTGTCTATGAAGAAGGTGATGCCCGTTCTGCACTCATCGCCATGCTCCAGTCCCTTCATCACGCCAAGAAT
GGCCTGGACATTGTATCCGGAACACGTGTCAAGTCCCACTTTGCCAAGCCTAATTGGCGTACAGTGTTCAAGCAAGTCGCTGTTCACCACCCTAATTCTCGAG
CAGGTGTGTTTTACTGT
GGGGCACCGGGATTGACGAAGGAGCTGCGAAACTTAGCTCTGGATTTCTCACACAAGACCACCACCAAGTTTGAATTCCACAAAGAGAACTTC

Retrieve as FASTA