Entry information : LuRboh102(Lus10019390|PACid:23181586)
Entry ID 12233
Creation 2013-05-29 (Qiang LI)
Last sequence changes 2013-05-30 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang Li)
Peroxidase information: LuRboh102(Lus10019390|PACid:23181586)
Name LuRboh102(Lus10019390|PACid:23181586)
Class Respiratory burst oxidase homolog    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuRboh102
start..stop
S start..stop
PtRboh05 913 0 33..668 187..846
EgrRboh06 893 0 33..668 179..857
EglRboh06 892 0 33..668 179..857
EguRboh06 890 0 33..668 179..857
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2024244..2024339 96 N° 2 2025523..2025570 48 N° 3 2025686..2025979 294 N° 4 2026833..2027381 549
N° 5 2027667..2027762 96 N° 6 2027869..2028188 320 N° 7 2028273..2028426 154 N° 8 2028503..2028634 132
N° 9 2028732..2028860 129 N° 10 2028966..2029044 79 N° 11 2029138..2029247 110  
join(2024244..2024339,2025523..2025570,2025686..2025979,2026833..2027381,2027667 ..2027762,2027869..2028188,2028273..2028426,2028503..2028634,2028732..2028860,20 28966..2029044,2029138..2029247)


exon

Literature and cross-references LuRboh102(Lus10019390|PACid:23181586)
DNA ref. Phytozome 11:   scaffold25 (2024244..2029247)
Protein sequence: LuRboh102(Lus10019390|PACid:23181586)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   668
PWM (Da):   %s   75561.21 Transmb domain:   %s   o256-278i298-320o330-349i490-507o
PI (pH):   %s   8.68
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLNSVEIDKMADVPINEARPSKASHPPRMSVDCDKNGDGKLSESEVKEVILLSASANKLNNLKENAGTYAALIMDEMDPDQRGYIEIWQVATLLCGMVNGDGSAEASTKMNRQAMSLARAMIPSRYRSPLTRSFTNASEYIHENWKVSGYCLCIAKATAETIKFNMAMILIPVCRRTLTSLRSTILGKFIPFDDNINFHKVISVAIAVASLAHTVAHVACNYPLIAQCPKDRFDTLIGSAFNYVQPTYGMLMMHSISVTGVLMDLIMAFSFTLATHSFRRNVVKLPGVIHNLAGFNAFWYAHHLLAVAYVLLFLHGWFLLTEKPWYEKTTWMYICGPVMLYALERVFLSYRERTEPVNIIKAVIYSGNVLALYMTKPMGFKYKSGMYIFVKCPNISSFEWHPFSITSAPDDDYLSVHIRTLGDWTKEMRNIFAKVCEPPQQAKPRGMNLMRMETRNVSDSNYDELQKTFPTILVKGPFGAPAQNYNKYDILLLVGLGIGATPMVSILKDLLNGLKPMKGEFSVEAATKKYPERAYFYWVTREQASFEWFKGVMDDIAEYDRNHIIEMHNYLTSVYEEGDARSALIAMVQKLQHAKNGVDIVSQSRIRTHFARPNWKRVFSELEKAHPSSHIGVFYCGSVALVKTLRELCQDFSLNSTTRFHFHKENF

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction. PS is missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTGAATAGCGTCGAGATCGATAAGATGGCCGACGTGCCCATAAACGAGGCACGTCCCAGCAAGGCCTCACACCCGCCGAGAATGTCGGTGGACATNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAAATTAAGGAGGAAAATTTAAGAAAAGAAGAGAAATTT
GATAATTTTATTTTCATGGAATAATACAATCGATTATGTTATGTGGTTGGAGCCTTAGAAATATCGGTTTTGCCCTATCTTTCTTTAATTAAAAAATCTAATCACACCTCACATGGCATC
TTCTAAAAAAAAACAAGTGTGTGTTATTTTTTTGATAGATGATATAATTATAAATAAAGTAGTTATATTATTTTTTTTAATTTTAATTTTTTTCATTAATAATTATCACTTAAAATCATC
CACCAATCACAGATTTATTCTAAAAATAACAAATTTCTTCCAAATCTCTAAAAAATTTGTCCCAAACTACTCCTAAGTAAATAAGCCAATGTTTCTGACCAACTTAATTGTGCAAATGTT
TACCAGACACCAGTGATTTCAATATTATAAAGTAATGCAGAATTCATTAAATTAATTTAATGCGTAATCTGGATGCAGGTGTGACAAGAACGGAGATGGAAAACTTTCAGAAAGTGAAGT
TAAGGAG
GTATTAATGAGAAAGTAGATGCATGATTAGTTTAATTTAATTAATTTTATATTTTCACGGCGGATTATCGAAAAATAATGCAGTGTGTTAATTAATTGAATTGCAATACGATC
AGGTGATACTGTTGAGCGCATCAGCGAACAAGCTAAACAACCTAAAGGAAAACGCAGGGACGTACGCAGCCTTAATAATGGACGAGATGGACCCTGACCAGCGTGGCTATATCGAGATAT
GGCAGGTCGCGACTCTCCTGTGCGGGATGGTCAACGGAGACGGCTCGGCCGAAGCGAGCACCAAAATGAACCGGCAAGCCATGTCTCTAGCCCGAGCCATGATTCCCAGTCGGTATAGAT
CCCCTTTGACTAGGTCCTTCACCAACGCCTCCGAGTACATCCACGAGAACTGGAAA
GTCATTTGGGTCCTCGCCTTCTGGGCCGCGGTCAACGCCTACCTCTTCTACTGGAAATTCTCCA
TCTTCATTGGAACCCCACTCTTCCAGGTAAATTGGCTCGCCAACTGTTGGAGTTCACATCGTTCATATCCGCTTCTCATCCATTGTAATCTCTAAGTTTGAGTAATAACCATCTTAAAAT
ATAATTTCGAATAATAGATTTCACATCCGTCGATTTTCAGTTAATCCTGTAACAGTAAAAAAAAATCGGGTTTCACAAAGTTCATCATTTTTCAAAACACTTAGATTTTATAAATCATTG
TAAAACTACATATCTCAAATATTTTATCATCCTAACTATAAAAACTATAAGAAATAGCAAGTATTCATAGAAGTGAGAGTTGGTTGGGGAAGTTAATAACGAATTATTTTCAGTCTTTTT
TCAATCGATTAAAAAATTTAATAAAAGTAAAGGTTAATTGATTAACCATAGTGATGATCGGTTAATTAGCTGACTTGAAACAAGTTGTCTAAGTTCGGTTCTGATTAAATAAATATAAAT
AGGAAGAGACTAAGTGTTAAAGTTATTTCGGTTAATGAAATTTGAAATGTTTAACCGATTCAATGAATCTGAATATATGTCTCACCCTTGGAACATAAAAAATCTCATTACAAAAATACT
TTTATAGGAATTAAATTGATCGATTTGGGTTTGGTTTATATACTTCAATATGCATATCCTACCGGATACGGTGTATATATCAATTTTTAAAATTATTCATATATTAAAAAAATTCAACCA
ACTTGAATTTTACCCTATACAGATTACCTATAATGATGGTTATTATTACCATCCTTCTACTTTCTGTAGGTCTCAGGATACTGTCTCTGTATAGCCAAGGCAACTGCCGAGACCATCAAG
TTCAACATGGCCATGATCCTCATCCCTGTATGTCGCCGGACCTTGACATCTCTCCGATCGACAATCCTCGGAAAGTTCATCCCGTTCGACGACAACATCAACTTCCACAAGGTCATCTCG
GTGGCGATCGCCGTGGCCTCCCTGGCCCACACCGTGGCACACGTGGCGTGTAACTATCCTCTGATAGCACAATGCCCAAAGGACAGGTTCGACACGCTCATCGGGAGCGCGTTTAACTAC
GTCCAGCCTACTTACGGGATGCTGATGATGCATTCGATAAGCGTGACGGGTGTGTTGATGGATTTGATAATGGCGTTCTCCTTCACACTCGCGACCCACTCTTTCCGGAGGAACGTGGTG
AAGCTGCCTGGGGTTATCCATAACTTGGCTGGTTTCAATGCTTTCTGGTATGCTCACCATTTGCTGGCCGTGGCTTATGTTCTGCTCTTCTTGCACGGTTGGTTCTTGCTCACTGAGAAG
CCTTGGTACGAGAAGACG
GTATGTAATTTTTTTAAAAATCTTATATATGTCAGAAGTATTCGTATTTGTCGACCTGTAGTTAGCATAAATCCCTTTAATATCGGTATACGTGCTAAATGT
GTTAAAACTCTCGTTCTCGTATTACTGTAGTGTTATCGGTTTTCCCCCTATATAGTATACATATACATATCATACGCGAGCTTGAGTTAGAAAGTTTTAGCTCGTACAGAGCTTTAGCTT
GACTCGTTTACTATCCTTGACGAGCCAAACTCCAACTGATGATGGGTTTCGTTGTGGGCGCAGACGTGGATGTATATATGTGGTCCGGTGATGTTGTATGCTTTAGAGAGAGTGTTTCTA
TCTTACAGGGAACGTACGGAGCCCGTCAACATAATTAAG
GTACGTTTAATTTGCATGCTCATCCACGTACAAATATGAAGGCGTACATGCATGCATGCATGCATGCGATATATATAATAC
CAAGTTTTGGGTGCATTCATTGCAGGCAGTAATATACTCGGGGAATGTTCTGGCACTGTACATGACGAAGCCAATGGGGTTCAAGTACAAAAGTGGGATGTACATCTTCGTGAAGTGTCC
CAACATCTCCAGCTTCGAATGGCATCCTTTCTCAATAACATCCGCACCGGATGACGATTACTTGAGCGTCCACATACGAACACTAGGAGACTGGACCAAAGAAATGAGAAACATATTCGC
CAAGGTATGCGAACCTCCCCAGCAAGCTAAACCCAGAGGAATGAACTTGATGAGAATGGAGACCAGGAATGTTTCCGACTCCAACTACGATGAACTTCAAAAAAC
GTTAGTATTTTTTTT
TTGTTATCTCAGATCTACTCAATAAAAGCCTCGATCAGTACGTAGCTAACATGTTAGGAAAAAAAACAGGTTTCCGACGATCCTGGTGAAAGGACCGTTCGGAGCCCCGGCCCAGAACTA
CAACAAGTACGACATATTGTTGCTGGTTGGACTAGGAATTGGAGCCACTCCTATGGTTAGCATTTTAAAGGATCTCCTGAATGGGCTCAAACCAATGAAGCCA
GTAAGCCAATCGAATCT
AGCTAGATTTTTAAAATCGAGAAATAAAATAAACAGATGGTAAAAATTGGAAATTGCAGGGAGAATTTTCAGTGGAGGCGGCAACGAAGAAGTACCCAGAGAGAGCCTACTTCTACTGGG
TTACAAGAGAACAAGCATCCTTCGAATGGTTTAAAGGAGTCATGGACGACATTGCCGAGTATGACCGAAAT
GTGAGCTTGCTTACGCTTTCTTTCTTCTTCTTTCTCTGTTTCAATTTCC
GCGAGTCTACTAATATGAAGAAAAGAAAAAATTCCTTGACAACAACAGCATATAATCGAGATGCACAATTACTTGACAAGCGTGTACGAGGAAGGAGACGCTAGGTCAGCACTCATTGCC
ATGGTCCAGAAGCTTCAGCACGCCAAGAATGGTGTCGATATCGTCTCCCAGAGCCGA
GTACGTACTAACTAGGCGCATGCATGCATGCATGCAGTGGACATTCATCTGGTTGAATTAATC
AAGCTATTTTATTTTATTATGAATTAAAAATCCAATTTGCAGATAAGGACACACTTTGCAAGACCCAACTGGAAAAGGGTTTTCTCTGAGCTGGAGAAGGCGCATCCGTCTTCTCATATC
G
GTACGTATACTATTGCAGTGTAAAGAAAAAGGAATTAATTGTGTTTATGATTAATTAATTAATTGAATTGGGTGCATGCATGGATGGATGCAGGGGTGTTCTACTGTGGTAGTGTAGCG
CTAGTGAAGACATTAAGGGAGCTGTGCCAGGACTTTAGTCTCAATTCAACTACCAGGTTCCATTTTCACAAGGAGAACTTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTGAATAGCGTCGAGATCGATAAGATGGCCGACGTGCCCATAAACGAGGCACGTCCCAGCAAGGCCTCACACCCGCCGAGAATGTCGGTGGACTGTGACAAGAACGGAGATGGAAAA
CTTTCAGAAAGTGAAGTTAAGGAG
GTGATACTGTTGAGCGCATCAGCGAACAAGCTAAACAACCTAAAGGAAAACGCAGGGACGTACGCAGCCTTAATAATGGACGAGATGGACCCTGAC
CAGCGTGGCTATATCGAGATATGGCAGGTCGCGACTCTCCTGTGCGGGATGGTCAACGGAGACGGCTCGGCCGAAGCGAGCACCAAAATGAACCGGCAAGCCATGTCTCTAGCCCGAGCC
ATGATTCCCAGTCGGTATAGATCCCCTTTGACTAGGTCCTTCACCAACGCCTCCGAGTACATCCACGAGAACTGGAAA
GTCTCAGGATACTGTCTCTGTATAGCCAAGGCAACTGCCGAG
ACCATCAAGTTCAACATGGCCATGATCCTCATCCCTGTATGTCGCCGGACCTTGACATCTCTCCGATCGACAATCCTCGGAAAGTTCATCCCGTTCGACGACAACATCAACTTCCACAAG
GTCATCTCGGTGGCGATCGCCGTGGCCTCCCTGGCCCACACCGTGGCACACGTGGCGTGTAACTATCCTCTGATAGCACAATGCCCAAAGGACAGGTTCGACACGCTCATCGGGAGCGCG
TTTAACTACGTCCAGCCTACTTACGGGATGCTGATGATGCATTCGATAAGCGTGACGGGTGTGTTGATGGATTTGATAATGGCGTTCTCCTTCACACTCGCGACCCACTCTTTCCGGAGG
AACGTGGTGAAGCTGCCTGGGGTTATCCATAACTTGGCTGGTTTCAATGCTTTCTGGTATGCTCACCATTTGCTGGCCGTGGCTTATGTTCTGCTCTTCTTGCACGGTTGGTTCTTGCTC
ACTGAGAAGCCTTGGTACGAGAAGACG
ACGTGGATGTATATATGTGGTCCGGTGATGTTGTATGCTTTAGAGAGAGTGTTTCTATCTTACAGGGAACGTACGGAGCCCGTCAACATAATT
AAG
GCAGTAATATACTCGGGGAATGTTCTGGCACTGTACATGACGAAGCCAATGGGGTTCAAGTACAAAAGTGGGATGTACATCTTCGTGAAGTGTCCCAACATCTCCAGCTTCGAATGG
CATCCTTTCTCAATAACATCCGCACCGGATGACGATTACTTGAGCGTCCACATACGAACACTAGGAGACTGGACCAAAGAAATGAGAAACATATTCGCCAAGGTATGCGAACCTCCCCAG
CAAGCTAAACCCAGAGGAATGAACTTGATGAGAATGGAGACCAGGAATGTTTCCGACTCCAACTACGATGAACTTCAAAAAAC
GTTTCCGACGATCCTGGTGAAAGGACCGTTCGGAGCC
CCGGCCCAGAACTACAACAAGTACGACATATTGTTGCTGGTTGGACTAGGAATTGGAGCCACTCCTATGGTTAGCATTTTAAAGGATCTCCTGAATGGGCTCAAACCAATGAAGCCA
GGA
GAATTTTCAGTGGAGGCGGCAACGAAGAAGTACCCAGAGAGAGCCTACTTCTACTGGGTTACAAGAGAACAAGCATCCTTCGAATGGTTTAAAGGAGTCATGGACGACATTGCCGAGTAT
GACCGAAAT
CATATAATCGAGATGCACAATTACTTGACAAGCGTGTACGAGGAAGGAGACGCTAGGTCAGCACTCATTGCCATGGTCCAGAAGCTTCAGCACGCCAAGAATGGTGTCGAT
ATCGTCTCCCAGAGCCGA
ATAAGGACACACTTTGCAAGACCCAACTGGAAAAGGGTTTTCTCTGAGCTGGAGAAGGCGCATCCGTCTTCTCATATCGGGGTGTTCTACTGTGGTAGTGTA
GCGCTAGTGAAGACATTAAGGGAGCTGTGCCAGGACTTTAGTCTCAATTCAACTACCAGGTTCCATTTTCACAAGGAGAACTTCTGA

Retrieve as FASTA