Entry information : Lu1CysPrx219
Entry ID 12234
Creation 2013-05-29 (Qiang LI)
Last sequence changes 2013-05-30 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: Lu1CysPrx219
Name Lu1CysPrx219
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Lu1CysPrx219
start..stop
S start..stop
Lu1CysPrx93 444 8e-162 1..220 1..220
Egu1CysPrx03 387 5e-139 1..220 1..220
Egr1CysPrx03 387 5e-139 1..220 1..220
Ecam1CysPrx03-2 384 5e-138 1..220 1..220
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 679677..679943 267 N° 2 679446..679592 147 N° 3 679116..679364 249  
complement(join(679116..679364,679446..679592,679677..679943))


exon

Literature and cross-references Lu1CysPrx219
DNA ref. Phytozome 11:   scaffold163 (679943..679116)
Protein sequence: Lu1CysPrx219
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   220
PWM (Da):   %s   24184.28  
PI (pH):   %s   5.63
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPGLTIGDTVPNLEVESTHGVINLHDFFTNSWTILFSHPGDFTPVCTTELGKMAAYAPEFEKRGVKLLGLSCDDVLSHVEWIKDVEAFTPGSKVTYPIISDPNREVIKELNMVDPDEKDPSGNNVPSRALHIVGPDKKIKLSFLYPASTGRNMEEVMRVVESLQKASKNKIATPVDWKPGDAVVISPSVSNEEADKMFPQGYKTADLPSKKGYLRFTHVD*

Retrieve as FASTA  
Remarks Complete sequence from genomic. No prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTGGACTCACCATCGGGGACACTGTCCCAAATCTGGAAGTGGAGAGCACTCATGGAGTCATCAATCTCCACGACTTCTTTACCAATTCCTGGACCATCCTCTTCTCTCACCCCGGT
GATTTCACGCCGGTGTGCACGACGGAGCTGGGGAAGATGGCAGCTTATGCGCCGGAGTTCGAGAAGAGAGGGGTCAAACTCCTGGGCTTGTCATGCGACGACGTTTTGTCTCACGTCGAG
TGGATCAAGGACGTTGAAGCCTTCACC
GTGAGCTAAAACTGATTTCCTTTATAATTTCGTCATGGCCGTTATCTAACGGAAACAGAGTGATTAATTTTATTTTAATTGTAGCCGGGGAGC
AAGGTGACTTACCCAATCATCTCCGATCCGAATCGGGAGGTGATCAAGGAGCTGAACATGGTGGATCCCGACGAGAAAGATCCGTCCGGGAACAACGTCCCTTCCCGTGCTCTGCATATT
GTGGGCCCTGATAAGAAG
GTTGATTTCTAGCTTAATTGCTTGGTTTATAATAGAGTTTGGGTTGGTTGGATTATTGATTGGGGGAAATGATGGATGCAGATAAAGCTGAGCTTTCTGTAC
CCGGCGAGCACGGGGAGGAACATGGAGGAAGTGATGAGGGTGGTGGAGTCGCTGCAGAAGGCGTCGAAGAACAAGATAGCAACTCCGGTGGACTGGAAGCCAGGGGATGCGGTGGTGATA
TCTCCCAGCGTGTCCAACGAGGAGGCTGATAAGATGTTCCCACAGGGGTACAAGACTGCCGACCTCCCTTCCAAGAAAGGCTACCTCCGCTTTACCCATGTTGACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTGGACTCACCATCGGGGACACTGTCCCAAATCTGGAAGTGGAGAGCACTCATGGAGTCATCAATCTCCACGACTTCTTTACCAATTCCTGGACCATCCTCTTCTCTCACCCCGGT
GATTTCACGCCGGTGTGCACGACGGAGCTGGGGAAGATGGCAGCTTATGCGCCGGAGTTCGAGAAGAGAGGGGTCAAACTCCTGGGCTTGTCATGCGACGACGTTTTGTCTCACGTCGAG
TGGATCAAGGACGTTGAAGCCTTCACC
CCGGGGAGCAAGGTGACTTACCCAATCATCTCCGATCCGAATCGGGAGGTGATCAAGGAGCTGAACATGGTGGATCCCGACGAGAAAGATCCG
TCCGGGAACAACGTCCCTTCCCGTGCTCTGCATATTGTGGGCCCTGATAAGAAG
ATAAAGCTGAGCTTTCTGTACCCGGCGAGCACGGGGAGGAACATGGAGGAAGTGATGAGGGTGGTG
GAGTCGCTGCAGAAGGCGTCGAAGAACAAGATAGCAACTCCGGTGGACTGGAAGCCAGGGGATGCGGTGGTGATATCTCCCAGCGTGTCCAACGAGGAGGCTGATAAGATGTTCCCACAG
GGGTACAAGACTGCCGACCTCCCTTCCAAGAAAGGCTACCTCCGCTTTACCCATGTTGACTAA

Retrieve as FASTA