Entry information : LfluCIIAC02
Entry ID 12236
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: LfluCIIAC02
Name LfluCIIAC02
Class Asco Class II type C    [Orthogroup: CIIAC001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Lentitheciaceae Lentithecium
Organism Lentithecium fluviatile    [TaxId: 690899 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LfluCIIAC02
start..stop
S start..stop
DexiCIIAC02 507 0 17..336 17..334
AbraCIIAC02 481 4e-172 1..336 1..341
AalteCIIAC02 475 8e-170 8..336 8..340
PtritCIIAC01 474 1e-169 1..336 1..341
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 73246..73489 244 N° 2 73542..74323 782  
join(73246..73489,73542..74323)


exon

Literature and cross-references LfluCIIAC02
DNA ref. JGI genome:   scaffold_77 (73246..74323)
Cluster/Prediction ref. JGI gene:   492793
Protein sequence: LfluCIIAC02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   342 (321)
PWM (Da):   %s   37491.18 (35170.8)  
PI (pH):   %s   7.29 (6.85) Peptide Signal:   %s   cut: 21 range:21-341
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFRNTIRALPLLLLATLAIASPHALEQREAAPGRVEDLLKGALNAIQQLIKDIITGAKSGITDEISNKPLVCLQRLDVCCVWYDVSAELTKNFKEKNGECNDNARAAVRFGFHDAGSWDKTSTHGGADGSLMMDFGEETRPENNGLQTVRTLLRSIQAKYKVGYADLAQYAHNHGTISCPKGPRIRTFVGRKDATQAAPTGLLPDVHDTADNLIALFDRKGFSAHDLAALVGAHASAKQRFVDPAQAGKPLDTTPGVWDVEFYNDTLNQPTKNNPNIFVLPSDAVLSVHPKINDEWISFVGDQPHWNEDYAKAYIKMSLLGVTNLKDLRDCTRTLPRKTNK*

Retrieve as FASTA  
Remarks complete sequence from genomics (1 intron)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTCGCAACACCATCCGCGCTCTCCCCCTCCTCCTATTGGCCACTCTCGCCATCGCCTCACCACACGCACTCGAGCAGCGCGAGGCAGCTCCTGGCCGCGTGGAAGACCTACTCAAG
GGCGCACTCAATGCCATCCAGCAATTGATCAAAGACATCATCACCGGAGCCAAATCCGGCATCACAGACGAGATATCAAACAAGCCCCTTGTTTGCTTGCAAAGGCTCGACGTCTGCTGC
GTCT
GTAAGTACCACCGCACCGCTCCTCCCTCCCGTCTTTGCTAACCTCAAACCAGGGTACGACGTCTCCGCCGAGCTCACAAAGAACTTCAAAGAAAAGAATGGCGAATGCAATGACAA
CGCCCGTGCTGCCGTCCGCTTCGGCTTCCATGACGCTGGATCATGGGACAAGACGTCAACCCACGGCGGCGCAGACGGCTCCCTCATGATGGACTTCGGCGAGGAAACTCGCCCAGAGAA
CAACGGCCTGCAGACGGTGCGCACCCTCCTCCGCAGCATCCAAGCCAAGTACAAAGTCGGGTACGCCGATCTCGCGCAGTACGCCCACAACCACGGCACCATCTCGTGTCCCAAGGGGCC
CCGCATCCGAACCTTCGTCGGCCGCAAAGACGCTACGCAGGCTGCTCCCACCGGCCTCCTTCCCGATGTGCACGACACGGCCGACAATCTCATCGCCCTCTTCGACCGCAAGGGCTTCTC
TGCCCATGACCTCGCTGCACTCGTTGGCGCCCATGCGTCTGCTAAGCAACGCTTCGTCGACCCCGCGCAGGCGGGCAAGCCCCTCGATACGACCCCGGGTGTTTGGGACGTCGAGTTCTA
CAACGACACGCTGAACCAGCCTACGAAGAATAACCCCAATATCTTTGTTCTGCCCTCTGACGCCGTTCTCTCTGTGCATCCTAAAATCAACGACGAGTGGATATCGTTCGTTGGCGATCA
GCCGCATTGGAATGAGGATTATGCTAAGGCGTATATCAAAATGAGTTTGTTGGGTGTGACGAATTTGAAGGACTTGAGGGATTGCACCAGGACGTTGCCAAGGAAGACGAATAAATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTCGCAACACCATCCGCGCTCTCCCCCTCCTCCTATTGGCCACTCTCGCCATCGCCTCACCACACGCACTCGAGCAGCGCGAGGCAGCTCCTGGCCGCGTGGAAGACCTACTCAAG
GGCGCACTCAATGCCATCCAGCAATTGATCAAAGACATCATCACCGGAGCCAAATCCGGCATCACAGACGAGATATCAAACAAGCCCCTTGTTTGCTTGCAAAGGCTCGACGTCTGCTGC
GTCT
GGTACGACGTCTCCGCCGAGCTCACAAAGAACTTCAAAGAAAAGAATGGCGAATGCAATGACAACGCCCGTGCTGCCGTCCGCTTCGGCTTCCATGACGCTGGATCATGGGACAAG
ACGTCAACCCACGGCGGCGCAGACGGCTCCCTCATGATGGACTTCGGCGAGGAAACTCGCCCAGAGAACAACGGCCTGCAGACGGTGCGCACCCTCCTCCGCAGCATCCAAGCCAAGTAC
AAAGTCGGGTACGCCGATCTCGCGCAGTACGCCCACAACCACGGCACCATCTCGTGTCCCAAGGGGCCCCGCATCCGAACCTTCGTCGGCCGCAAAGACGCTACGCAGGCTGCTCCCACC
GGCCTCCTTCCCGATGTGCACGACACGGCCGACAATCTCATCGCCCTCTTCGACCGCAAGGGCTTCTCTGCCCATGACCTCGCTGCACTCGTTGGCGCCCATGCGTCTGCTAAGCAACGC
TTCGTCGACCCCGCGCAGGCGGGCAAGCCCCTCGATACGACCCCGGGTGTTTGGGACGTCGAGTTCTACAACGACACGCTGAACCAGCCTACGAAGAATAACCCCAATATCTTTGTTCTG
CCCTCTGACGCCGTTCTCTCTGTGCATCCTAAAATCAACGACGAGTGGATATCGTTCGTTGGCGATCAGCCGCATTGGAATGAGGATTATGCTAAGGCGTATATCAAAATGAGTTTGTTG
GGTGTGACGAATTTGAAGGACTTGAGGGATTGCACCAGGACGTTGCCAAGGAAGACGAATAAATGA

Retrieve as FASTA