Entry information : LuGPx220
Entry ID 12237
Creation 2013-05-29 (Qiang LI)
Last sequence changes 2013-05-30 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuGPx220
Name LuGPx220
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuGPx220
start..stop
S start..stop
LuGPx46 454 5e-165 1..238 1..236
PtGPx06-2 323 2e-113 1..238 1..238
LuGPx40 321 2e-113 70..238 1..169
ThasGPx06-2 314 1e-109 34..237 41..239
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 323070..323327 258 N° 2 322913..322989 77 N° 3 322762..322823 62 N° 4 322378..322496 119
N° 5 321993..322160 168 N° 6 321860..321892 33  
complement(join(321860..321892,321993..322160,322378..322496,322762..322823,3229 13..322989,323070..323327))


exon

Literature and cross-references LuGPx220
DNA ref. Phytozome 11:   scaffold835 (323327..321860)
Protein sequence: LuGPx220
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   238
PWM (Da):   %s   26276.59  
PI (pH):   %s   9.86
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLCSSIRNLARKNLIFTVTASSASSLLRTRPLRSISYLGLSDSRLPHRRSVSLNQSPVLVACSARFDRAMASNSKAPQSIYDFTVKDARGNDVDLSTYKGKVLLIVNVASQCGLTNSNYTELTELYKKYKDGLEILAFPCNQFGSQEPGSNEQIMEFACTRFKAEYPIFDVDVNGNNAAPIYKFLKSSKGGLFGDGIKWNFAKFLINKEGQVVDRYAPTTSPLSFEKDVKKLLGVA*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCTGTTCTTCAATCCGCAACCTCGCCCGTAAAAATCTCATCTTTACAGTTACAGCCTCATCCGCTTCTTCTCTTCTTCGCACCAGACCTCTCCGATCGATTTCTTATCTGGGTTTG
TCCGATTCTCGTCTTCCGCATCGGCGATCAGTTTCCTTGAACCAGTCCCCCGTCTTGGTTGCTTGTTCTGCCAGATTCGATCGAGCTATGGCCAGCAACTCCAAAGCTCCTCAGTCCATT
TACGACTTCACTGTCAAG
GTATAAATAAAATTGGGGGTTTCCTTGTATTGGATTGAAATTATTGGCTGTCTGAATTTTTGGATTCTGGTTGTTTGCAGGACGCTAGAGGGAATGATGTTG
ATCTCAGTACTTACAAGGGCAAAGTTCTTTTGATTGTCAATGTCGCCTCCCAATG
GTAAATTTCCCAGCTTTATTTCACTAAGGGGTTAGTTGTGTATGGAACATGAAAATTTACTGTTT
GTTGGTCTTTGAACTTTGTTGCAGTGGCTTGACCAATTCGAATTACACTGAGCTGACTGAGCTGTACAAGAAATACAAAGATCAAGGTTTTCCTCTTCGCCCAGATTCTGTGTTTGATTG
TGATTAGTGACATAAGAGTACATTCAATCCTTGGCTTGTGTGCATAATTACTAATGGTCTTCTGAATCGGATTATCGAGCTTATTCATTACAAGTACTGTATTCATTCTTGGCCTTCAAG
TAGAGGTGTTGTGGGAAATTATCAGTAATCTATTTGATCTCAGTCTAAGCTCAATGGTCTGTGTTTGTGATGACTAGTAACTCATTTTCCCCCACTTGTTGGCTGGAGCAGGCCTAGAGA
TCTTGGCTTTCCCTTGCAATCAGTTTGGATCTCAGGAACCTGGAAGCAACGAGCAAATCATGGAGTTTGCTTGTACTCGCTTCAAGGCCGAGTACCCCATTTTCGACAAG
GTGAGGTTCG
GAGGTCGACTATACAATTAACCATGATCTAGACTAGAGACGCTTCAAACCAAATATTTTAGCTGTGGTGTTATGAATACTCAAGGCATCAATTAACCTTATGAATACCCATATCCTTAAA
TCGACTAAAGACTCTACGACGATGTGCATACCTTGTAGTAGAATTCAACTTGATGGTAGTTTGTTTTTGTTTTCAACACTAATACAGGTTGATGTGAACGGGAACAATGCTGCTCCAATC
TACAAGTTCCTCAAGTCAAGCAAAGGTGGCCTCTTTGGGGATGGTATCAAGTGGAACTTTGCCAAGTTCCTCATCAACAAAGAGGGGCAGGTGGTCGATCGCTATGCTCCTACTACCTCC
CCTCTCAGCTTCGAG
GTAAGCAGATAAAACACACCCGAGTTATGTTTCCTTTTCGGTTGTCCTGATCGATGACTAACTCTGCCCATGTATGTATTTCCTTTGGTAAAATTTGCAGAAAGA
TGTGAAAAAACTGCTTGGGGTTGCCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCTGTTCTTCAATCCGCAACCTCGCCCGTAAAAATCTCATCTTTACAGTTACAGCCTCATCCGCTTCTTCTCTTCTTCGCACCAGACCTCTCCGATCGATTTCTTATCTGGGTTTG
TCCGATTCTCGTCTTCCGCATCGGCGATCAGTTTCCTTGAACCAGTCCCCCGTCTTGGTTGCTTGTTCTGCCAGATTCGATCGAGCTATGGCCAGCAACTCCAAAGCTCCTCAGTCCATT
TACGACTTCACTGTCAAG
GACGCTAGAGGGAATGATGTTGATCTCAGTACTTACAAGGGCAAAGTTCTTTTGATTGTCAATGTCGCCTCCCAATGTGGCTTGACCAATTCGAATTACACT
GAGCTGACTGAGCTGTACAAGAAATACAAAGATCAAG
GCCTAGAGATCTTGGCTTTCCCTTGCAATCAGTTTGGATCTCAGGAACCTGGAAGCAACGAGCAAATCATGGAGTTTGCTTGT
ACTCGCTTCAAGGCCGAGTACCCCATTTTCGACAAG
GTTGATGTGAACGGGAACAATGCTGCTCCAATCTACAAGTTCCTCAAGTCAAGCAAAGGTGGCCTCTTTGGGGATGGTATCAAG
TGGAACTTTGCCAAGTTCCTCATCAACAAAGAGGGGCAGGTGGTCGATCGCTATGCTCCTACTACCTCCCCTCTCAGCTTCGAG
AAAGATGTGAAAAAACTGCTTGGGGTTGCCTAG

Retrieve as FASTA