Entry information : LuGPx221
Entry ID 12239
Creation 2013-05-29 (Qiang LI)
Last sequence changes 2013-05-30 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang LI)
Peroxidase information: LuGPx221
Name LuGPx221
Class Plant glutathione peroxidase    [Orthogroup: Gpx2003]
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuGPx221
start..stop
S start..stop
LuGPx142 336 2e-120 1..174 1..173
PtGPx02 292 3e-103 7..169 2..164
CclGPx02 282 9e-99 2..169 34..201
HbGPx02 276 5e-97 7..169 2..164
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 394998..395057 60 N° 2 395158..395234 77 N° 3 396383..396444 62 N° 4 396926..397044 119
N° 5 397125..397352 228  
join(394998..395057,395158..395234,396383..396444,396926..397044,397125..397352)


exon

Literature and cross-references LuGPx221
DNA ref. Phytozome 11:   scaffold145 (394998..397352)
Protein sequence: LuGPx221
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   181
PWM (Da):   %s   19878.08  
PI (pH):   %s   7.18
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MADSSSSSSSPNSIYDFTVKDIKGSGVSLSEYKGKVLLIVNVASKCGLTHANYKELNMLYQKYKDGLEILAFPCNQFGGQEPGTIDQIQDTVCTIFKAEFPIFDVDVNGKNTAEVYRYLKSEKGGFLGDAIKWNFTKFLVNKQGKVMERYAPTTSPLKIEKDIQNLLEIASASDSISSL*

Retrieve as FASTA  
Remarks Complete sequence from genomic. No prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGATTCTTCTTCTTCTTCTTCATCTCCAAACTCCATCTATGACTTCACTGTTAAGGTATTTTATTCATTCTCCTTTCTGGGTTTCTTCAAAGTTGCAGTTGGGTTTGGATGAGAA
TCTGTAATTTTACTCGGTTTCTTATCCATGGATTTTGCAGGATATAAAGGGGAGTGGTGTGAGTCTGAGTGAATACAAGGGGAAGGTTCTTCTCATTGTCAATGTTGCTTCCAAATGGTA
ATTTTCACTATTTTGGACTCAAATTCGTGATGTTCATCTATTCTGGTACATGACTTGCAGAGATTTCGGTTATGTTTCTTATAAAAGAGAATCTAGGTTAGTCGGAAAATATTGAGTTGA
GGTTGAAAGGGATTGCGAAAGAAAAGTTGAATTTAAAGGATGTAAAGGATTACCTACGAAAAGTAAAATTCTCCTTACCGTAGCTTGGGAAACACAATTCCACTATGAATCTCTTCTCTT
ATATGACTTTATTCAACTTTCCTTCCACAAAATCTACCAAAAGTCAACTCAACTTTATTCCATTAACCTCAATTTAACTTCGAAATATGATTTTAGATGTCAAACCTTACCGTTATTTCT
GCTCCATTACTTCCATATAGCATCACCCAATTGAATTGATAATGAATCAAAATGTTTTTGATATGTTTCATAATCAGTCAATTGTCTGCTAATTATTACTCCCGTCAGATGTAATCTGTC
AGAATCTCCCATGGCATTGGTACACAGTAATGAACTATTTTGACCAAGTGTCCAGAAAAAAAAACCCAGTATGCACACTTAGCTGGCATGAATTACCATTTTCAGAGTTATGTTTTTGGG
GAGCAGATGGGTTTTGGATTATGTATGTATTTGGAAGGAAGCTGACTGTGAGAGTGCTCCCCAAACCTCAAGGTGTGATATAGTTATTAGGACCATTGTACCCACTTGCTGGTAAGAGTT
TAAACTACTGACGAAGATACACGTTCGAGTTTGATCATATCGATCATATAGCTAAGAAAGTGGCTGCTTGCTGTTTAAGTCGATGGGTCGGAGAGAAACTCCGGAAAGATCGAAACTTGG
TTGTTGGTTTGCAGTGCAAGTTAAAGGAAATCTCTTATGGTTCTAACGCTCGGTTTTCCTTGCTTGGTTAAAAGTTTGTTTTAGCACCAACACGTCTGTCGTAGCTAACAATGTCTCTGC
TTGCTGTTTAAGTCGATGGGGTTTGAGAGATTCCGGAAATATCGAAACTTGGTTGTTGTTTCTGCAGTGGCCGAAGTAGCAGGAAATCTATGGTTCTAAGCCTGATGTTTTTTCATGCTT
GGTTAGAGTTTGTATTAGCACTAACTGGGTATTTGATTGGTTTTAACAACTCTGCACACTTTCAGTGGGTTGACACACGCAAACTACAAGGAATTGAACATGCTGTACCAGAAATACAAA
GACCAAG
GTTAGTCCTGCAATCACCTTTCCCTCAGTTTCTTCAAACTCTAACCGGTTATTTTTTGGTGTGTGGTATTCTGGAGCAAAATGATGCATTAATTATTTGAGAATGTGAGTTTA
TGAGGTGTCAATGGGTTGTGGTGTGTGAATTATCTTGTTTGACTAACGAGTTATTCAATATGATATTTGATAATGCCAAAATAGTCGAAATATTGCAGTATTTCAACTACCTTAGGGGAA
GGTATTTGAAACAACAGGAAAGTAAATTATTTGAAATACCACAACCTGAAATGCAATAGATTTCGTCGTCGATGCAAAACCAGTTATTTTGAAAGTGGGTTATTTGAAATACCACGGTCG
CAAATGCCACAAATTTTGTGTTGGATCCGAAATGAGTTATTTTGTCCCAAATAACTCATACAAACGACTTCTAAAAGGAAAACATAAAACTTATGTTTCTCTGCAAAATTGGTAATGAGC
TATCTCAGGGCTAGAGATCCTAGCATTCCCTTGCAACCAGTTTGGTGGACAAGAACCAGGAACCATTGACCAAATTCAGGACACTGTATGCACCATCTTCAAAGCTGAATTCCCAATCTT
TGATAAG
GTAGAGTCTTTTCTTCTACATTCCTCGATGAAATATCGACCACCCAAAACGTGACATATTCTGGGGTCGGGTTTTTGCAGGTCGATGTGAACGGGAAGAACACTGCAGAGGTG
TACAGGTACTTGAAGTCGGAGAAAGGAGGGTTTCTGGGAGATGCAATCAAATGGAACTTCACAAAGTTCCTGGTGAACAAACAAGGCAAAGTCATGGAGCGTTACGCTCCCACTACTTCG
CCTCTTAAGATCGAGAAGGATATCCAGAACCTGTTGGAAATTGCTTCTGCTTCAGATTCCATTTCCAGCCTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGATTCTTCTTCTTCTTCTTCATCTCCAAACTCCATCTATGACTTCACTGTTAAGGATATAAAGGGGAGTGGTGTGAGTCTGAGTGAATACAAGGGGAAGGTTCTTCTCATTGTC
AATGTTGCTTCCAAATG
TGGGTTGACACACGCAAACTACAAGGAATTGAACATGCTGTACCAGAAATACAAAGACCAAGGGCTAGAGATCCTAGCATTCCCTTGCAACCAGTTTGGTGGA
CAAGAACCAGGAACCATTGACCAAATTCAGGACACTGTATGCACCATCTTCAAAGCTGAATTCCCAATCTTTGATAAG
GTCGATGTGAACGGGAAGAACACTGCAGAGGTGTACAGGTAC
TTGAAGTCGGAGAAAGGAGGGTTTCTGGGAGATGCAATCAAATGGAACTTCACAAAGTTCCTGGTGAACAAACAAGGCAAAGTCATGGAGCGTTACGCTCCCACTACTTCGCCTCTTAAG
ATCGAGAAGGATATCCAGAACCTGTTGGAAATTGCTTCTGCTTCAGATTCCATTTCCAGCCTCTAA

Retrieve as FASTA