Entry information : LfluCIIAB03
Entry ID 12244
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: LfluCIIAB03
Name LfluCIIAB03
Class Asco Class II type B     [Orthogroup: CIIAB001]*
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Lentitheciaceae Lentithecium
Organism Lentithecium fluviatile    [TaxId: 690899 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LfluCIIAB03
start..stop
S start..stop
RrufCIIAB01 316 9e-109 1..256 20..276
DescCIIAB01 309 8e-107 12..252 21..266
HEC38CIIAB01 303 2e-104 12..252 21..262
HCO27CIIAB01 287 3e-98 12..252 21..262
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 431044..431050 7 N° 2 430693..430989 297 N° 3 430173..430637 465 N° 4 429819..429838 20
complement(join(429819..429838,430173..430637,430693..430989,431044..431050))


exon

Literature and cross-references LfluCIIAB03
DNA ref. JGI genome:   scaffold_20 (431050..429819)
Cluster/Prediction ref. JGI gene:   479017
Protein sequence: LfluCIIAB03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   262
PWM (Da):   %s   27229.67  
PI (pH):   %s   4.15
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRDTPNAIEKRQSSCPSVWTDVGTDLRSILVSDGTCTDSARAAIRLAFHDCFPGSCDGSVIVANECTTRVENAQMVDICGTLGDKATSFNVSTADMIQFAAAIGIASCTGGPVTSFYAGRTDNTTANPTGQLDGPNTDAATLVAHFAAKGFSITEMVALAGAHTIGRQLDSSAMDSTVGEWDSSFYGEVANGSTANPLNSDRFLSNSSDTSAQWSSVGASSSSFESAFVPAMEKMSLLGNDKSSLTDCSDVVKSYANMIEWA

Retrieve as FASTA  
Remarks incorrect sequence from genomics (3 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCGGTACTCCCGTCGTTCTTTTCGCCGGCCTCGTTGCCACCTCTCACGCATTTGTAGACACTCCAAATGCTATCGAGAAACGCCAGTCAAGCTGCCCATCAGTCTGGACGGATGTC
GGTACAGACCTACGAAGCATACTGGTTTCAGACGGCACATGCACAGACAGCGCCCGAGCTGCAATCCGTCTCGCCTTCCACGACTGCTTCCCAGGTTCATGTGATGGCTCGGTCATTGTC
GCAAACGAATGTACAACCCGCGTGGAAAATGCGCAAATGGTGGACATTTGCGGTACGTTGGGCGACAAGGCTACGAGCTTCAATGTCAGCACTGCTGATATGATTCAGTTTGCAGCAG
GT
ACGATCTTACTCTCCTCTATCCTCGATATGAACCTCTACTAACCATGCCTCAGCCATAGGGATAGCTTCCTGCACTGGCGGGCCAGTTACATCGTTCTACGCGGGCCGGACCGACAACAC
GACCGCCAATCCAACAGGTCAACTTGACGGCCCTAATACCGATGCCGCTACGCTTGTTGCCCACTTCGCCGCCAAGGGCTTCTCAATCACTGAAATGGTCGCCCTGGCCGGCGCACACAC
TATCGGACGTCAGCTCGACAGCTCTGCTATGGACTCTACCGTAGGCGAATGGGACTCCAGCTTCTACGGCGAAGTCGCGAATGGCAGTACCGCAAACCCGTTAAACAGCGATCGCTTCCT
CAGCAACTCGAGTGATACTAGTGCGCAGTGGAGTAGTGTGGGAGCGAGCAGTAGTAGTTTCGAAAGCGCGTTTGTGCCGGCGATGGAGAAGATGAGTTTGTTGGGTAATGATAAGAGCTC
GTTGACAGATTGCTCCGATGTGGTGAAGAGCTATGCGA
GTGCGTTGGTGGAGCAGAAGGCTGTCGCTCAGGGAGCCGACCGGAGTAGTGAGCAGAACGGCGGCACTACCAGTGCTTCGGG
TAGTGTGGTAAGTGGGCAGGTCACGAGCGTGGCGTGGAGGAGGGTCGAAGCTGTTGGATGGCTTGGGTTGGTGTTGATTCCAGTTGTTGTTATGCTTGCTTAGCTGTCGATCTGAGTGTT
GGTAAGCTGGCCAGCATTCTACGGTGTTCGCAGTCGATACATCGACACTATGGTAATAAAGCACAGGTCTCTGTAATATGTTCATCCGAAACTAAAGGTATGCTTGAGTCTCTTTGACTA
TTTGTCTAGCAGATATGATCGAATGGGCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCGACACTCCAAATGCTATCGAGAAACGCCAGTCAAGCTGCCCATCAGTCTGGACGGATGTCGGTACAGACCTACGAAGCATACTGGTTTCAGACGGCACATGCACAGACAGCGCC
CGAGCTGCAATCCGTCTCGCCTTCCACGACTGCTTCCCAGGTTCATGTGATGGCTCGGTCATTGTCGCAAACGAATGTACAACCCGCGTGGAAAATGCGCAAATGGTGGACATTTGCGGT
ACGTTGGGCGACAAGGCTACGAGCTTCAATGTCAGCACTGCTGATATGATTCAGTTTGCAGCAG
CCATAGGGATAGCTTCCTGCACTGGCGGGCCAGTTACATCGTTCTACGCGGGCCGG
ACCGACAACACGACCGCCAATCCAACAGGTCAACTTGACGGCCCTAATACCGATGCCGCTACGCTTGTTGCCCACTTCGCCGCCAAGGGCTTCTCAATCACTGAAATGGTCGCCCTGGCC
GGCGCACACACTATCGGACGTCAGCTCGACAGCTCTGCTATGGACTCTACCGTAGGCGAATGGGACTCCAGCTTCTACGGCGAAGTCGCGAATGGCAGTACCGCAAACCCGTTAAACAGC
GATCGCTTCCTCAGCAACTCGAGTGATACTAGTGCGCAGTGGAGTAGTGTGGGAGCGAGCAGTAGTAGTTTCGAAAGCGCGTTTGTGCCGGCGATGGAGAAGATGAGTTTGTTGGGTAAT
GATAAGAGCTCGTTGACAGATTGCTCCGATGTGGTGAAGAGCTATGCGA
ATATGATCGAATGGGCCTGA

Retrieve as FASTA