Entry information : LfluGPx01
Entry ID 12246
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-29 (Christophe Dunand)
Peroxidase information: LfluGPx01
Name LfluGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Lentitheciaceae Lentithecium
Organism Lentithecium fluviatile    [TaxId: 690899 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LfluGPx01
start..stop
S start..stop
AalteGPx01 304 7e-106 1..232 1..239
PnoGPx 303 1e-105 1..229 1..219
ClunGPx01 300 2e-105 66..230 1..166
ZcelGPx01 302 3e-105 49..229 35..213
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1327674..1327911 238 N° 2 1327983..1328440 458  
join(1327674..1327911,1327983..1328440)


exon

Literature and cross-references LfluGPx01
DNA ref. JGI genome:   scaffold_8 (1327674..1328440)
Cluster/Prediction ref. JGI gene:   416190
Protein sequence: LfluGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   233
PWM (Da):   %s   25989.7  
PI (pH):   %s   10.28
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIRRLCTAPLRVAPQSKQISHHRVNRLIAQRPQPTALFFTLTKSTPLQLSALPIQTRELRASFATMASATTFFDFKPKDKKGSEFDLAGLKGKVVLVVNTASKCGFTPQFEGLEKLYKDTKATHPDFEILGFPCNQFGGQDPGSNDEIQNFCQVNYGVTFPVLGKIDVNGDSADPVFEWLKKEKPGVMGLKRVKWNFEKFLVGRDGKVKQRWASTTKPESLKAEIEKELAK

Retrieve as FASTA  
Remarks complete sequence from genomics (1 intron)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCCGGCGGCTTTGCACTGCCCCGCTTCGCGTCGCCCCCCAGTCCAAACAGATATCGCACCATCGTGTCAACCGGCTCATCGCGCAACGACCACAACCCACGGCACTCTTCTTCACA
CTCACCAAATCTACGCCTCTGCAACTCTCAGCTCTTCCTATACAGACACGAGAGCTTCGAGCAAGTTTCGCGACCATGGCTTCTGCGACTACATTTTTCGACTTCAAGCCCAAGGACA
GT
ATGTCCCCTAAGCTTTTCTTGAGCAAGAAGACGTACGAGACATGTGGGCGGGGTGCTGACGGTCAACAGAGAAGGGCAGCGAGTTCGACCTCGCCGGCCTCAAGGGTAAAGTCGTCCTCG
TGGTGAACACTGCGTCAAAGTGCGGCTTCACGCCCCAATTCGAGGGCCTGGAGAAACTATACAAAGACACCAAGGCCACGCATCCCGACTTTGAGATCCTCGGCTTCCCCTGCAACCAGT
TCGGCGGCCAGGACCCCGGCTCCAACGACGAGATCCAGAACTTCTGCCAGGTCAACTACGGCGTCACCTTCCCCGTGCTCGGCAAGATCGACGTCAACGGCGACAGCGCAGACCCCGTGT
TCGAGTGGCTCAAGAAGGAGAAGCCGGGCGTCATGGGCTTGAAGCGCGTCAAGTGGAACTTTGAGAAGTTCTTGGTCGGCAGGGATGGAAAGGTCAAGCAGAGGTGGGCTAGCACCACAA
AGCCGGAGAGCCTGAAGGCGGAGATTGAAAAAGAGCTGGCGAAGAAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCCGGCGGCTTTGCACTGCCCCGCTTCGCGTCGCCCCCCAGTCCAAACAGATATCGCACCATCGTGTCAACCGGCTCATCGCGCAACGACCACAACCCACGGCACTCTTCTTCACA
CTCACCAAATCTACGCCTCTGCAACTCTCAGCTCTTCCTATACAGACACGAGAGCTTCGAGCAAGTTTCGCGACCATGGCTTCTGCGACTACATTTTTCGACTTCAAGCCCAAGGACA
AG
AAGGGCAGCGAGTTCGACCTCGCCGGCCTCAAGGGTAAAGTCGTCCTCGTGGTGAACACTGCGTCAAAGTGCGGCTTCACGCCCCAATTCGAGGGCCTGGAGAAACTATACAAAGACACC
AAGGCCACGCATCCCGACTTTGAGATCCTCGGCTTCCCCTGCAACCAGTTCGGCGGCCAGGACCCCGGCTCCAACGACGAGATCCAGAACTTCTGCCAGGTCAACTACGGCGTCACCTTC
CCCGTGCTCGGCAAGATCGACGTCAACGGCGACAGCGCAGACCCCGTGTTCGAGTGGCTCAAGAAGGAGAAGCCGGGCGTCATGGGCTTGAAGCGCGTCAAGTGGAACTTTGAGAAGTTC
TTGGTCGGCAGGGATGGAAAGGTCAAGCAGAGGTGGGCTAGCACCACAAAGCCGGAGAGCCTGAAGGCGGAGATTGAAAAAGAGCTGGCGAAGAAA

Retrieve as FASTA