Entry information : DexiCIIAA01
Entry ID 12248
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: DexiCIIAA01
Name DexiCIIAA01
Class Asco Class II type A    [Orthogroup: CIIAA001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Didymellaceae Didymella
Organism Didymella exigua    [TaxId: 100019 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value DexiCIIAA01
start..stop
S start..stop
LfluCIIAA03 469 5e-166 8..407 7..375
GsteCIIAA01 442 2e-155 77..410 45..377
BdotCIIAA02 408 5e-142 1..410 1..371
DserCIIAA 398 7e-138 1..408 1..378
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 135042..135741 700 N° 2 134459..134991 533  
complement(join(134459..134991,135042..135741))


exon

Literature and cross-references DexiCIIAA01
DNA ref. JGI genome:   scaffold_3 (135741..134459)
Cluster/Prediction ref. JGI gene:   1210
Protein sequence: DexiCIIAA01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   411 (388)
PWM (Da):   %s   44363.77 (41954.5)  
PI (pH):   %s   8.46 (8.56) Peptide Signal:   %s   cut: 23 range:23-410
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLSLIVVAGLGALTVFECTYAYPGMGATVDEVKQRIQGRQQLSGHQRLASNARRQTTKVPDPNDTQDPNAVEDVADAAPKLIGDIKDGGTTAVGKAIARIITEQETGQSSVGGYQIPGSLGTFKCKADTCCVWAHISLQLTNIFRGQSGRCKKYARAAIRLGFHDAGTWKDGLDFGGADGSIILAKEEISRPDNKGLQDIVRVLGNMYRQTFKQYGIGVADLIQFAAKHAVVTCPLGPRIRTFVGRKDSSRANMDGLLPGVNDSADTLIALFAAKTIGPHELTALLGAHTASQQFHVDPSRAAAPQDGTPGVWDTLFYNQTLGLGPLPKAVFRFPSDVVLAQDPRTRDEWRKFSIGREGQEDWNEDYAYSYIRLSLLGVNNINQLTECTKVLPMPTKSFRGAGDLLIAE*

Retrieve as FASTA  
Remarks complete sequence from genomics (1 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTATCACTAATAGTTGTCGCTGGCCTCGGCGCCCTTACTGTTTTTGAGTGCACATATGCCTACCCAGGAATGGGTGCCACAGTAGACGAGGTCAAGCAAAGGATACAAGGGAGG
CAGCAACTTTCCGGGCATCAAAGACTAGCATCGAACGCCCGACGCCAGACAACCAAGGTCCCAGATCCCAACGATACGCAAGACCCCAACGCGGTTGAAGATGTGGCCGATGCAGCACCT
AAGCTGATTGGAGACATCAAAGATGGCGGTACAACCGCTGTCGGCAAAGCAATCGCTCGGATCATCACCGAGCAAGAAACAGGCCAAAGCAGTGTCGGCGGATACCAGATTCCTGGCTCG
CTTGGCACGTTCAAGTGCAAAGCAGATACCTGCTGCGTCTGGGCACATATCTCTCTCCAGCTCACAAACATCTTCCGCGGCCAATCTGGCCGCTGCAAAAAGTACGCTCGCGCCGCCATC
CGGCTCGGCTTCCACGACGCCGGAACGTGGAAAGATGGTCTTGACTTTGGTGGTGCGGACGGCAGTATCATTCTCGCCAAGGAAGAGATCTCTCGCCCCGACAACAAAGGTCTACAAGAC
ATCGTCCGCGTCCTCGGCAACATGTACAGGCAGACATTCAAACAATACGGCATCGGCGTAGCAGACCTCATCCAATTCGCTGCCAAACACGCCGTCGTCA
GTGCGTATCTTTACCGCCCC
GAATCTAAGCCCGGGTCTAACACAACGCAGCATGCCCGCTCGGTCCGCGCATCCGCACTTTCGTCGGCCGCAAAGACTCCTCCAGAGCGAACATGGACGGCCTGCTCCCCGGCGTCAACG
ACTCGGCAGACACCCTCATCGCGCTCTTCGCGGCCAAAACAATCGGCCCCCACGAGCTCACCGCGCTGCTGGGCGCGCACACAGCGAGTCAGCAGTTCCACGTCGACCCCTCGCGCGCCG
CGGCGCCCCAGGACGGCACTCCGGGCGTTTGGGATACTCTTTTCTACAACCAGACGCTGGGCCTGGGGCCGCTGCCCAAAGCTGTCTTCCGGTTTCCGAGCGATGTTGTGCTTGCGCAGG
ATCCGAGGACGAGGGACGAGTGGAGGAAGTTCAGCATTGGGAGGGAGGGGCAGGAGGATTGGAATGAGGATTATGCATATAGCTATATCAGGTTGAGTTTGTTGGGGGTCAACAATATCA
ATCAGCTTACCGAGTGCACTAAGGTGCTGCCTATGCCGACGAAGAGCTTCAGGGGGGCGGGCGATTTGTTGATTGCGGAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTATCACTAATAGTTGTCGCTGGCCTCGGCGCCCTTACTGTTTTTGAGTGCACATATGCCTACCCAGGAATGGGTGCCACAGTAGACGAGGTCAAGCAAAGGATACAAGGGAGG
CAGCAACTTTCCGGGCATCAAAGACTAGCATCGAACGCCCGACGCCAGACAACCAAGGTCCCAGATCCCAACGATACGCAAGACCCCAACGCGGTTGAAGATGTGGCCGATGCAGCACCT
AAGCTGATTGGAGACATCAAAGATGGCGGTACAACCGCTGTCGGCAAAGCAATCGCTCGGATCATCACCGAGCAAGAAACAGGCCAAAGCAGTGTCGGCGGATACCAGATTCCTGGCTCG
CTTGGCACGTTCAAGTGCAAAGCAGATACCTGCTGCGTCTGGGCACATATCTCTCTCCAGCTCACAAACATCTTCCGCGGCCAATCTGGCCGCTGCAAAAAGTACGCTCGCGCCGCCATC
CGGCTCGGCTTCCACGACGCCGGAACGTGGAAAGATGGTCTTGACTTTGGTGGTGCGGACGGCAGTATCATTCTCGCCAAGGAAGAGATCTCTCGCCCCGACAACAAAGGTCTACAAGAC
ATCGTCCGCGTCCTCGGCAACATGTACAGGCAGACATTCAAACAATACGGCATCGGCGTAGCAGACCTCATCCAATTCGCTGCCAAACACGCCGTCGTCA
CATGCCCGCTCGGTCCGCGC
ATCCGCACTTTCGTCGGCCGCAAAGACTCCTCCAGAGCGAACATGGACGGCCTGCTCCCCGGCGTCAACGACTCGGCAGACACCCTCATCGCGCTCTTCGCGGCCAAAACAATCGGCCCC
CACGAGCTCACCGCGCTGCTGGGCGCGCACACAGCGAGTCAGCAGTTCCACGTCGACCCCTCGCGCGCCGCGGCGCCCCAGGACGGCACTCCGGGCGTTTGGGATACTCTTTTCTACAAC
CAGACGCTGGGCCTGGGGCCGCTGCCCAAAGCTGTCTTCCGGTTTCCGAGCGATGTTGTGCTTGCGCAGGATCCGAGGACGAGGGACGAGTGGAGGAAGTTCAGCATTGGGAGGGAGGGG
CAGGAGGATTGGAATGAGGATTATGCATATAGCTATATCAGGTTGAGTTTGTTGGGGGTCAACAATATCAATCAGCTTACCGAGTGCACTAAGGTGCTGCCTATGCCGACGAAGAGCTTC
AGGGGGGCGGGCGATTTGTTGATTGCGGAGTAG

Retrieve as FASTA