Entry information : LuRboh[P]232
Entry ID 12249
Creation 2013-05-30 (Qiang LI)
Last sequence changes 2013-05-30 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2013-05-30 (Qiang Li)
Peroxidase information: LuRboh[P]232
Name LuRboh[P]232
Class Respiratory burst oxidase homolog    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Linaceae Linum
Organism Linum usitatissimum (flax)    [TaxId: 4006 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LuRboh[P]232
start..stop
S start..stop
LuRboh[P]218 1033 0 11..637 1..631
PtRboh07 1020 0 36..637 182..909
CsiRboh01 976 0 33..637 200..922
CsiRboh01 52 0.0000006 3..80 34..147
LeRboh02 963 0 29..637 194..938
LeRboh02 49 0.000005 11..75 70..139
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 510541..510570 30 N° 2 510394..510468 75 N° 3 509915..509971 57 N° 4 509672..509719 48
N° 5 509397..509507 111 N° 6 508493..509233 741 N° 7 508052..508173 122 N° 8 507840..507928 89
N° 9 507673..507735 63 N° 10 507072..507223 152 N° 11 506648..506957 310 N° 12 505951..506057 107
complement(join(505951..506057,506648..506957,507072..507223,507673..507735,5078 40..507928,508052..508173,508493..509233,509397..509507,509672..509719,509915..5 09971,510394..510468,510541..510570))


exon

Literature and cross-references LuRboh[P]232
DNA ref. Phytozome 11:   scaffold38 (510570..505951)
Protein sequence: LuRboh[P]232
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   635
PWM (Da):   %s   71454.99 Transmb domain:   %s   o143-162i283-305o325-347i471-488o
PI (pH):   %s   8.73
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
SGPLSGPLNKEITLDLRDDSVAVHSVKAANGTEEDMKESKEFALELYDTLARKRKDADGRITEEEVKEVCTLSASANKLSTIQKQAEEYAALIMEELDPEHHGYIMVKLLSQKLKPTLDENPISRWLRDAKYFLLDNWQRVWVMALWIGVMAGLFAYKYVQYRNRAAYEVMGACVCLAKGAAETLKLNMALILLPVCRNTITWLRNKTKLGLAVPFDDNLNFHKVIAVAITIGVGIHGISHLACDFPRLLDASDEKWELMEPFFGDQXPSSYWHFVKSKEGVTGIVMVILMAIAFTLATPWFRRNKLXNLPPLLKKLTGFNAFWYSHHLFVIVYTLLVVHGYYLYLTKEWYKKTL*VAIYPGNVLALHMSKPSGFRYKSGQYMFVNCAAVSPFEWHPFSITSAPGDDYLSVHIRTLGDWTRQLSVFL*VCQPPATGKSGLLRADVVGSFPKILIDGPYGAPAQDYKQYEVVLLVGLGIGATPMISIVKDIVNNMFRTRRAYFYWVTREQGSFDWFKGVMNEVAELDQNQVIELHNYCTSVYEEGDARSALIAMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVFKQVAVHHPHSRVGVFYCGAPGLTKELRNLALDFSHKTTTKFDFHKEN

Retrieve as FASTA  
Remarks Pseudogene from genomic. 5' end is missing . Stop in frame.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGCGGGCCATTAAGCGGTCCACTGAACAAAAAAGGTGGAAGAAAGAGCGCCAGGTTCAACATACCTGCTGATCAGACTAGCTCGTCCGACCAGCAGTATGTTGAGATCACGCTCGATCTC
AGAGATGATTCGGTGGCCGTTCACAGCGTTAAAGCTGCCAACGGCACGGAGGAAGAT
CCCGAGATGACACTTCTAGCCAAAGGCTTGGAGAAGCGCACGGCTTCCAATCTTGGTTCATCT
GCGATGAGAAGTGCTTCTGCTCGAATCCGTCAAGTTTCTCAAGAGCTGAGGCGGCTCACTTCCATTAACAAAAGGCCCACGGGTCGGCTTGACAGGACCAAGTCGGCAGCGGCTCATGCT
CTCAAGGGTCTCAAGTTCATCAGTAAGGCCGACGGTGGCTCCGGATGGGTTGCTGTGGAGAAGAGGTTCGATGAAATCACCGATGGGATGCTTCCTCGCTCTCGCTTTGGGGAATGCATT
GGTATGGCATGCATACCAACTGTTTGACAACTTGTCACTTCTGAGAATTATATTAAAGAGATCCATGATCAAGTTCTAAATTATTATGCTTGTGTGTATCTTGTTAATCTTTGATAGGAA
TGAAGGAGTCAAAGGAATTCGCCTTGGAGTTGTATGATACTCTCGCTAGGAAGAGA
AACATTCAGAGGGATTCAATCACCAAGTCTGAGTTGAAGGACTTCTGGGATCAGATTTCCAACC
AGAGCTTCGATTCCAGGCTCCAGACTTTCTTTGACATGTACTAAATTACCTCTTTTGTCCTTCTTGGTTAAATTGGGAACACAAAGTCAATGTTGGGCAATTTATATTGTGAAAATTATT
TCAGGGTTGATAAGGATGCAGATGGTAGAATTACTGAAGAGGAAGTTAAGGAGGTATGTATACCATTGGAATATCATTTTGAAGGGTTGACTTGACGACTAACGTGGTTTTTGGAGGGAA
TTGTGGCATGTGCTTGAGATGAGAGGTGGATTTCGTCTGAAGATTTCCCCTTTTTTGTTTTTTGTTTTAATTTTAATTTTAATGAATATTTTGGCAGATCATTACTCTCAGTGCATCTGC
AAACAAGCTTTCGACTATCCAAAAACAAGCAGAGGAGTATGCTGCTTTGATTATGGAAGAATTGGATCCTGAACACCATGGATACATCATGGTA
ATGTAGAATTTGATCTCTTTGATAGC
ACCATGCATATATAGAGTAGCAGTAGTAGGTGTCCTGAATGGGTCCGTTTGATTACAAACAGATAGAGAGCTTGGAAATGCTGTTGCTGCAAGGACCAAGCCAGTCTGTTAGAGCAGCAG
ACAGCAAGAACCTGAGCAAACTGTTGAGCCAGAAGCTAAAGCCGACACTGGACGAGAACCCAATCAGTAGATGGTTGAGAGACGCGAAATACTTTTTATTGGACAACTGGCAGAGAGTTT
GGGTGATGGCTCTGTGGATTGGGGTAATGGCTGGCCTATTTGCTTATAAGTACGTGCAATATCGCAACAGAGCTGCATACGAGGTCATGGGCGCTTGTGTCTGCCTAGCTAAAGGTGCTG
CCGAAACACTCAAACTAAATATGGCTTTGATTCTGCTTCCTGTCTGCCGGAACACAATCACATGGCTCAGGAATAAGACCAAACTAGGACTTGCTGTTCCTTTTGATGACAACCTCAACT
TTCACAAGGTTATAGCGGTGGCAATAACAATTGGAGTAGGCATCCATGGCATATCCCATTTGGCCTGTGACTTTCCTCGTCTTCTAGATGCAAGCGATGAGAAATGGGAACTTATGGAGC
CATTTTTTGGAGACCAGNNNCCGTCGAGCTACTGGCATTTCGTTAAGTCAAAGGAAGGGGTCACTGGGATTGTGATGGTTATTCTGATGGCGATAGCTTTCACACTTGCCACTCCTTGGT
TCAGGCGAAACAAGCTCNNNAATTTGCCACCTTTGTTGAAGAAGCTAACAGGATTCAATGCCTTTTGGTACTCCCACCATTTGTTTGTCATTGTCTACACTCTGCTTGTAGTTCACGGTT
ACTATCTCTACCTCACCAAGGAATGGTACAAGAAGACA
GTAAGTGCTGCGGAACCTTTAATTTTTATTCCCCTGCTATATATATGGATTCCGTAATGAAACCTGAGCAGCCTTTAATTGG
GAACTCTTACAAAATTTCAGACCTGGATGTACTTGGCTGTTCCAGTAGTTCTTTATGGCAGCGAGAGGTTGACAAGGGCATTGAGGTCCAGCATCAAGGCAGTTACCATAAGGAAGGTAA
TTTGATTTGTCCAACCACACGCAGTACAGGAAAGTACAGTAGTCCATTTAACATCTCATTAAAGAAATACAAAGCAGGAGAGGATGAGCACTGAAACCCGGTTTAATTTGTGGTTATTTA
TAGGTGGCAATTTATCCTGGAAACGTGTTGGCACTTCACATGTCAAAGCCTAGTGGGTTCAGATACAAGAGTGGGCAGTACATGTTTGTGAATTGTGCTGCAGTGTCTCCATTTGAATG
G
TACTAATTAATTAAGGAGCATTATCTCTTTTAAATGACTCTTTTAAGATTTGACATTACGATCCAGTAAATGAGCCCTTTAACTTTATGGTTTTGACTGACGAATTTGTGAATATCCAAC
AGGCACCCATTCTCCATCACTTCTGCTCCCGGAGATGATTATTTGAGCGTTCACATCAGAACACTGGGTGACTGGACGAGGCAGCTCAGAACTGTTTTCCAAGAGGTACTACAGAATTAT
ATGACTACTTGTCTATGTTTTGTAAAGTAAGATGCATGTTTGCCTAGGACTTGTATAATTTTGTAATTTCTCTTGGCGTCTTTTTATAGGTGTGTCAACCACCGGCGACAGGGAAGAGTG
GACTTCTCAGAGCGGATG
GATTTCAGGGAAACAACAATCCTGAGTAAGTTGTAATTTTTGAAGTAGCTAATTGATGATACTGACATTGACAACAGTGAGTGATAGATTATAATAAGCTGG
CCCTTGAAAAATAAGGGCGGAAAACGACAAACCAAAACAACTCATTTTCTGACCATTTCAAAGAGCTAGGGAGCATTGATTTACACCAAAACACAAAATTGCTGTCTTTCTTAGTATTTG
GTGTTTGTACACTTTGATGATGATTGATGAAGACCGCCATATATTAATGTCATCAGCCAAAATCCATGTTGCTTTCATAATAAAAAAAGAACAGATGATGAAGCATCATAGGTGCTGCTA
AATACTAAAAGTTATGGGCATGATTATATAGCTAGCTCCAACCACAAAACGGCTGTCTTTTTCTGTTGCTACAAATAAATAAACTCTTAAGTGTGTTATAATAATGTTTGTTGGCAGTTT
TCCAAAAATATTGATCGACGGACCATATGGAGCTCCGGCACAAGATTACAAACAATACGAAGTTGTTCTGCTAGTGGGACTGGGGATAGGAGCCACACCCATGATCAGCATTGTCAAGGA
CATAGTAAACAACATGAAG
GCCATGGATGACTTGGAGAACGGCGCAACAACTGCACCCAGTGCCGCGTCGCCTCCTTCAATAAGCCACCAATCTGGCTCGTCCTCACACTCCAACAGTAA
GAGGAAAGAACAGTTCAGGACTAGAAGGGCCTACTTTTATTGGGTAACAAGGGAGCAAGGCTCCTTCGACTGGTTTAAAGGTGTGATGAACGAGGTTGCTGAATTGGATCAAAACCAAGT
GATAGAGCTCCATAACTACTGCACCAGTGTGTACGAAGAGGGAGATGCACGTTCTGCACTCATTGCTATGCTCCAATCCCTTCACCACGCTAAAAACGGGGTTGACATTGTCTCGGGGAC
ACGTGTCAAATCCCACTTCGCCAAACCCAACTGGCGTAACGTTTTCAAGCAAGTTGCCGTTCACCATCCTCATTCCCGAGTTG
GTACGTACATCATCATCATCATCCATTGGTTATGTTA
TGTTTTTGTTTTTAGTTTCTCAGGATAGAATTATTTTGTTCCACAACGAAATCATCATCCCTTGGTTATGTTTTGTTCAAATGAAAAAAACCATCATCTATATATGCAGCAATGCACATG
ACAATAATACAGGGCAGACAAGTAGGGATAATCATTTGGGGAATGCTTTCGTCTCCCTGTTCATTCTGCTCATCAAAATAATTAAAAAAAACCCTAAAATAATATATAATTTTTCTTATT
ATATCCTAATAACTCGAGTGGTTAGAAAATAGTTATTATAAATCGTATATCATCCGCTCATATAACAACACATAATAATAGCATAATAATAGCTGTAGGTCCAAAATGAGAGTGCTTTGT
GTCATATCATGGAGCCTTTTGGAAAATCAATCAGTGTACTCTTCCCTCTTATTGTAATCTTCTAGAATTTCAAAGGTGTTTTATGGGTGGGTGATACTTCCACTAACAATGCTTGGTTGA
CAAGTAATAAGCCACTAATTAGATGGTTAATAATTTATGATAGTGGTTGATTATGATACTGCTGCTACTGCAGGGGTGTTTTATTGTGGGGCACCTGGATTGACAAAGGAGCTCCGCAAC
TTGGCTCTGGATTTCTCGCATAAGACCACCACCAAGTTTGATTTCCACAAGGAGAACTTC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGCGGGCCATTAAGCGGTCCACTGAACAAAGAGATCACGCTCGATCTCAGAGATGATTCGGTGGCCGTTCACAGCGTTAAAGCTGCCAACGGCACGGAGGAAGATATGAAGGAGTCAAAG
GAATTCGCCTTGGAGTTGTATGATACTCTCGCTAGGAAGAGA
AAGGATGCAGATGGTAGAATTACTGAAGAGGAAGTTAAGGAGGTATGTACTCTCAGTGCATCTGCAAACAAGCTTTCG
ACTATCCAAAAACAAGCAGAGGAGTATGCTGCTTTGATTATGGAAGAATTGGATCCTGAACACCATGGATACATCATGGTA
AAACTGTTGAGCCAGAAGCTAAAGCCGACACTGGACGAG
AACCCAATCAGTAGATGGTTGAGAGACGCGAAATACTTTTTATTGGACAACTGGCAGAGAGTTTGGGTGATGGCTCTGTGGATTGGGGTAATGGCTGGCCTATTTGCTTATAAGTACGTG
CAATATCGCAACAGAGCTGCATACGAGGTCATGGGCGCTTGTGTCTGCCTAGCTAAAGGTGCTGCCGAAACACTCAAACTAAATATGGCTTTGATTCTGCTTCCTGTCTGCCGGAACACA
ATCACATGGCTCAGGAATAAGACCAAACTAGGACTTGCTGTTCCTTTTGATGACAACCTCAACTTTCACAAGGTTATAGCGGTGGCAATAACAATTGGAGTAGGCATCCATGGCATATCC
CATTTGGCCTGTGACTTTCCTCGTCTTCTAGATGCAAGCGATGAGAAATGGGAACTTATGGAGCCATTTTTTGGAGACCAGNNNCCGTCGAGCTACTGGCATTTCGTTAAGTCAAAGGAA
GGGGTCACTGGGATTGTGATGGTTATTCTGATGGCGATAGCTTTCACACTTGCCACTCCTTGGTTCAGGCGAAACAAGCTCNNNAATTTGCCACCTTTGTTGAAGAAGCTAACAGGATTC
AATGCCTTTTGGTACTCCCACCATTTGTTTGTCATTGTCTACACTCTGCTTGTAGTTCACGGTTACTATCTCTACCTCACCAAGGAATGGTACAAGAAGACA
TTATAGGTGGCAATTTAT
CCTGGAAACGTGTTGGCACTTCACATGTCAAAGCCTAGTGGGTTCAGATACAAGAGTGGGCAGTACATGTTTGTGAATTGTGCTGCAGTGTCTCCATTTGAATG
GCACCCATTCTCCATC
ACTTCTGCTCCCGGAGATGATTATTTGAGCGTTCACATCAGAACACTGGGTGACTGGACGAGGCAGCTCAGAA
GCGTCTTTTTATAGGTGTGTCAACCACCGGCGACAGGGAAGAGTGGA
CTTCTCAGAGCGGATG
TTGTTGGCAGTTTTCCAAAAATATTGATCGACGGACCATATGGAGCTCCGGCACAAGATTACAAACAATACGAAGTTGTTCTGCTAGTGGGACTGGGGATAGGA
GCCACACCCATGATCAGCATTGTCAAGGACATAGTAAACAACATGAAG
TTCAGGACTAGAAGGGCCTACTTTTATTGGGTAACAAGGGAGCAAGGCTCCTTCGACTGGTTTAAAGGTGTG
ATGAACGAGGTTGCTGAATTGGATCAAAACCAAGTGATAGAGCTCCATAACTACTGCACCAGTGTGTACGAAGAGGGAGATGCACGTTCTGCACTCATTGCTATGCTCCAATCCCTTCAC
CACGCTAAAAACGGGGTTGACATTGTCTCGGGGACACGTGTCAAATCCCACTTCGCCAAACCCAACTGGCGTAACGTTTTCAAGCAAGTTGCCGTTCACCATCCTCATTCCCGAGTTG
GG
GTGTTTTATTGTGGGGCACCTGGATTGACAAAGGAGCTCCGCAACTTGGCTCTGGATTTCTCGCATAAGACCACCACCAAGTTTGATTTCCACAAGGAGAACTTC

Retrieve as FASTA