Entry information : DexiCIIAC01
Entry ID 12254
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: DexiCIIAC01
Name DexiCIIAC01
Class Asco Class II type C    [Orthogroup: CIIAC001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Didymellaceae Didymella
Organism Didymella exigua    [TaxId: 100019 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value DexiCIIAC01
start..stop
S start..stop
LfluCIIAC01 427 9e-152 1..314 1..324
LfluCIIAC03 421 2e-149 1..310 1..307
PnoCIIAC03 419 1e-148 23..314 20..314
GsteCIIAA03 380 4e-133 1..309 1..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 447603..447834 232 N° 2 447883..448038 156 N° 3 448088..448353 266 N° 4 448407..448697 291
join(447603..447834,447883..448038,448088..448353,448407..448697)


exon

Literature and cross-references DexiCIIAC01
DNA ref. JGI genome:   scaffold_2 (447603..448697)
Cluster/Prediction ref. JGI gene:   415654
Protein sequence: DexiCIIAC01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   315 (299)
PWM (Da):   %s   33026.59 (31412.7)  
PI (pH):   %s   7.84 (7.42) Peptide Signal:   %s   cut: 16 range:16-314
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHLANLLLLASSAAAVSLPNFLDVSSLFTRDILARSSGSCPAVWTQISKDLTAKFLTDGQCNPDARAAIRAVFHDCGAWNKAQGAKGGCDGSLILANEVALPENNGLQGIAAYLQTLASNYKVGVADMIVFAGSHAIVTCPGGPRVQTYVGRKDSSTPAPEGLLPDVNASADSLYKLFLDKGLDASDLAALLGSHSTSNQFHFDESAGNVGAPQDSTPGIWDVKYYSETTAPPKGVLVLPSDAKLAAHATVGKEFKGFVNNAGKWNGKFADAMARMERFGSNGTNGLIDCTKALPSATNAKREFRGMPMFKPRH*

Retrieve as FASTA  
Remarks complete sequence from genomics (3 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATCTCGCCAATCTTCTTCTGTTGGCCTCATCCGCCGCAGCAGTTTCACTGCCAAACTTCCTCGATGTTTCATCACTCTTCACTCGCGACATCCTTGCTCGCAGCTCTGGCTCGTGT
CCCGCTGTCTGGACCCAGATCTCCAAGGACTTGACAGCAAAGTTCTTGACAGATGGGCAATGCAATCCCGATGCTCGCGCAGCTATACGAGCTGTGTTCCACGACTGCGGAG
GTTCGTCA
CTCCTATACACACCTAGCCCCAATCACTTATAAATCTCAGCATGGAACAAAGCCCAAGGCGCCAAAGGCGGTTGTGATGGAAGTCTCATCCTTGCAAACGAAGTTGCTCTACCTGAGAAC
AACGGTCTCCAAGGCATCGCCGCCTATCTGCAAACACTTGCCAGTAATTACAAAGTTGGCGTCGCAGACATGATCG
GTATGTGTTTCATCTACTCCACAGCATCCGCTCTTACTAATTCA
CACAGTCTTTGCAGGTTCCCACGCAATTGTTACCTGCCCGGGCGGCCCACGTGTGCAGACATACGTCGGCCGCAAGGACTCAAGCACCCCTGCGCCAGAAGGTCTCCTTCCTGACGTCAA
CGCGTCCGCAGATAGCCTTTACAAGCTCTTCCTAGACAAAGGCCTTGACGCAAGTGACCTCGCGGCCCTCCTCGGTTCACACTCGACCTCCAACCAATTCCACTTTGACGAGAGCGCAGG
AAATGTCGGCGCGCCTCAGGACTCAACCCCC
GTGAGCCCTGAACTCTAAGCCCTAAACCTGACCCTAACTAACCCAAACACTAGGGCATCTGGGATGTAAAATACTATTCAGAGACCACC
GCACCGCCCAAGGGCGTTTTGGTGCTGCCCTCTGATGCCAAGCTTGCTGCGCATGCCACCGTTGGCAAGGAGTTCAAGGGATTCGTTAATAACGCAGGGAAGTGGAATGGTAAGTTTGCG
GATGCGATGGCGCGTATGGAGAGGTTTGGGAGTAATGGGACTAATGGTTTGATTGATTGCACCAAGGCGTTGCCGAGTGCGACGAATGCAAAGAGGGAGTTCAGGGGAATGCCGATGTTC
AAGCCGAGGCATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATCTCGCCAATCTTCTTCTGTTGGCCTCATCCGCCGCAGCAGTTTCACTGCCAAACTTCCTCGATGTTTCATCACTCTTCACTCGCGACATCCTTGCTCGCAGCTCTGGCTCGTGT
CCCGCTGTCTGGACCCAGATCTCCAAGGACTTGACAGCAAAGTTCTTGACAGATGGGCAATGCAATCCCGATGCTCGCGCAGCTATACGAGCTGTGTTCCACGACTGCGGAG
CATGGAAC
AAAGCCCAAGGCGCCAAAGGCGGTTGTGATGGAAGTCTCATCCTTGCAAACGAAGTTGCTCTACCTGAGAACAACGGTCTCCAAGGCATCGCCGCCTATCTGCAAACACTTGCCAGTAAT
TACAAAGTTGGCGTCGCAGACATGATCG
TCTTTGCAGGTTCCCACGCAATTGTTACCTGCCCGGGCGGCCCACGTGTGCAGACATACGTCGGCCGCAAGGACTCAAGCACCCCTGCGCCA
GAAGGTCTCCTTCCTGACGTCAACGCGTCCGCAGATAGCCTTTACAAGCTCTTCCTAGACAAAGGCCTTGACGCAAGTGACCTCGCGGCCCTCCTCGGTTCACACTCGACCTCCAACCAA
TTCCACTTTGACGAGAGCGCAGGAAATGTCGGCGCGCCTCAGGACTCAACCCCC
GGCATCTGGGATGTAAAATACTATTCAGAGACCACCGCACCGCCCAAGGGCGTTTTGGTGCTGCCC
TCTGATGCCAAGCTTGCTGCGCATGCCACCGTTGGCAAGGAGTTCAAGGGATTCGTTAATAACGCAGGGAAGTGGAATGGTAAGTTTGCGGATGCGATGGCGCGTATGGAGAGGTTTGGG
AGTAATGGGACTAATGGTTTGATTGATTGCACCAAGGCGTTGCCGAGTGCGACGAATGCAAAGAGGGAGTTCAGGGGAATGCCGATGTTCAAGCCGAGGCATTAG

Retrieve as FASTA