Entry information : DexiCIIAB01
Entry ID 12255
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: DexiCIIAB01
Name DexiCIIAB01
Class Asco Class II type B    [Orthogroup: CIIAB001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Didymellaceae Didymella
Organism Didymella exigua    [TaxId: 100019 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value DexiCIIAB01
start..stop
S start..stop
Ssrc1lsm3aCIIAB06 412 2e-146 9..293 7..289
AalteCIIAB01 370 3e-130 10..265 9..264
ClunCIIAB02 367 5e-129 9..265 8..265
PnoCIIAB04 353 2e-123 10..293 8..289
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13328..14002 675 N° 2 14055..14276 222  
join(13328..14002,14055..14276)


exon

Literature and cross-references DexiCIIAB01
DNA ref. JGI genome:   scaffold_37 (13328..14276)
Cluster/Prediction ref. JGI gene:   424646
Protein sequence: DexiCIIAB01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   299 (279)
PWM (Da):   %s   31679.83 (29682.8)  
PI (pH):   %s   5.78 (6.27) Peptide Signal:   %s   cut: 20 range:20-298
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MYTSALASSLLILVSTTSALSLLPRTDSCPKVWSTVLPELQIAFAGCGRDAHGAIRAPFHDCINNGCDGSLILTDECSRAESAGLSDICGKLLSWTQKYNTSAADMIEFAAAVAISSCPLGPRVRALVGRKDSREAAPLNSIPGSRDSISSILDKFKAKGFSGDDVVALMGTHSVAVQVNDDPAQAGKSLDSTPSIYDLKFYQETLDGTAPYTLQSDRGLANNTETQKKWKEFADGDTSAWITAFTDAWNRFAVIGNDVGSLQDCSGIIPSGASERRLAKRLGSSAAARAFVRRLYDS*

Retrieve as FASTA  
Remarks complete sequence from genomics (1 intron)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTACACCTCAGCATTGGCATCATCACTGCTCATCCTCGTCTCCACAACATCAGCACTAAGCCTCCTCCCTCGCACAGACTCTTGCCCAAAGGTTTGGTCAACAGTCCTTCCGGAACTG
CAAATTGCCTTTGCTGGCTGTGGTCGTGATGCACATGGCGCCATCCGCGCCCCATTCCACGACTGTATCAACAACGGCTGCGACGGCAGTCTGATCTTGACCGATGAATGCAGCCGTGCG
GAGAGTGCTGGACTGTCAGATATCTGCGGAAAGCTACTTTCCTGGACACAGAAGTACAATACTAGCGCCGCAGACATGATCGAATTCGCGGCCGCGGTCGCTATCTCGTCATGTCCACTT
GGTCCTCGTGTCAGAGCATTGGTGGGCCGGAAAGACAGCAGGGAAGCTGCGCCGCTGAACAGCATACCCGGTAGCCGGGACTCGATCTCATCTATCCTAGACAAGTTTAAGGCAAAGGGC
TTCAGCGGTGACGACGTTGTGGCGCTGATGGGAACGCACTCCGTGGCTGTGCAGGTCAACGATGATCCCGCGCAAGCAGGAAAGAGTCTGGACTCGACGCCAAGTATTTATGATTTGAAG
TTCTACCAGGAAACTTTGGATGGCACGGCTCCATACACCTTGCAGAGTGACAGAGGTCTTGCGAACAACACTGAG
GTGGGTGACCCAAAATAATCCTACATTAAATGCAAAATCTAACAC
AAAGTAGACACAAAAGAAATGGAAAGAGTTTGCAGATGGTGACACCAGTGCTTGGATCACTGCATTCACTGATGCTTGGAACCGGTTTGCTGTTATCGGTAACGATGTAGGCAGTCTGCA
AGACTGCTCTGGTATCATCCCATCCGGTGCTTCGGAGAGAAGACTCGCGAAGAGGCTCGGCAGTTCGGCGGCAGCAAGAGCGTTTGTCAGGCGGTTATACGACTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTACACCTCAGCATTGGCATCATCACTGCTCATCCTCGTCTCCACAACATCAGCACTAAGCCTCCTCCCTCGCACAGACTCTTGCCCAAAGGTTTGGTCAACAGTCCTTCCGGAACTG
CAAATTGCCTTTGCTGGCTGTGGTCGTGATGCACATGGCGCCATCCGCGCCCCATTCCACGACTGTATCAACAACGGCTGCGACGGCAGTCTGATCTTGACCGATGAATGCAGCCGTGCG
GAGAGTGCTGGACTGTCAGATATCTGCGGAAAGCTACTTTCCTGGACACAGAAGTACAATACTAGCGCCGCAGACATGATCGAATTCGCGGCCGCGGTCGCTATCTCGTCATGTCCACTT
GGTCCTCGTGTCAGAGCATTGGTGGGCCGGAAAGACAGCAGGGAAGCTGCGCCGCTGAACAGCATACCCGGTAGCCGGGACTCGATCTCATCTATCCTAGACAAGTTTAAGGCAAAGGGC
TTCAGCGGTGACGACGTTGTGGCGCTGATGGGAACGCACTCCGTGGCTGTGCAGGTCAACGATGATCCCGCGCAAGCAGGAAAGAGTCTGGACTCGACGCCAAGTATTTATGATTTGAAG
TTCTACCAGGAAACTTTGGATGGCACGGCTCCATACACCTTGCAGAGTGACAGAGGTCTTGCGAACAACACTGAG
ACACAAAAGAAATGGAAAGAGTTTGCAGATGGTGACACCAGTGCT
TGGATCACTGCATTCACTGATGCTTGGAACCGGTTTGCTGTTATCGGTAACGATGTAGGCAGTCTGCAAGACTGCTCTGGTATCATCCCATCCGGTGCTTCGGAGAGAAGACTCGCGAAG
AGGCTCGGCAGTTCGGCGGCAGCAAGAGCGTTTGTCAGGCGGTTATACGACTCTTGA

Retrieve as FASTA