Entry information : DexiCP01
Entry ID 12256
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: DexiCP01
Name DexiCP01
Class Catalase peroxidase    [Orthogroup: CP001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Didymellaceae Didymella
Organism Didymella exigua    [TaxId: 100019 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value DexiCP01
start..stop
S start..stop
AalteCP01 1323 0 1..761 1..760
PtritCP01 1308 0 1..761 1..760
PterCP 1308 0 1..761 1..760
ClunCP01 1303 0 1..761 1..760
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 381518..381777 260 N° 2 379440..381465 2026  
complement(join(379440..381465,381518..381777))


exon

Literature and cross-references DexiCP01
DNA ref. JGI genome:   scaffold_17 (381777..379440)
Cluster/Prediction ref. JGI gene:   421808
Protein sequence: DexiCP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   762
PWM (Da):   %s   84287.88  
PI (pH):   %s   5.65
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSAGECPMKAANVSGGGTQTRDWWPNELRLNVLRQHDPRQVPFGQDFDYAEEFKKLDYDALKKDIAALMTDSQDWWPADFGHYGGLFIRMAWHSAGTYRVSDGRGGGGEGQQRFAPLNAWPDNVSLDKARRLLWPIKQKYGNKISWADLMLLTGNVALETMDCPTFGFAGGRADTYQSAEDVYWGGETEWLGNDVRYHDGNKGVEGEGIMDGDQHKNDVTSKEQVHTQRDLEKPLAAAHMGLIYVNPEGPDGVPDPVAAAHDIRTTFGRMAMNDEETAALIVGGHSFGKTHGAAPSDNTGTDPNGADLAAQGFGWENKHGRGNGPDTITSGLEVTWTGTPTKWSNKYLEYLYKFEWELEKSPAGASQYVAKGADAIIPDAYDSNKKHKPRMLTTDLSMRFDPAYEKITRRWLEHPEELHDAFTRAWFKLLHRDMGPRSRWLGPELPKEVLIWEDPVPEQQGEVIGESDISALKKEILDAGVEPSKLIRVAWASAASFRGSDKRGGANGARIRLEPQKNWEVNNPAELQEVLKALEGVKSKSSKNVSLADLIVLAGVAALEKASGVSVPFTPGRTDATQEQTDVQSFEHLEPVTDGFRNYGKGTERVRTEQLDVDKANLLRLTAPEMTVLVGGLRSLNANWDGSSHGVFTKRPGQLTNDFFVNLLDNNVEWKGADSSSPHELYEGKDRKSGQKKWTGTRHDLIFGSHPELRSIAEIYAQPDNADKFVKDFVAAWDKVMNLDRYDVKAKAVSGTSSVSSRPRL*

Retrieve as FASTA  
Remarks complete sequence from genomics (1 intron)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGCAGGCGAGTGTCCCATGAAGGCAGCCAACGTGTCTGGTGGCGGTACTCAGACACGCGACTGGTGGCCGAACGAGCTCAGGCTCAACGTCCTCCGCCAGCACGACCCCCGCCAG
GTTCCCTTTGGCCAGGACTTTGACTATGCTGAGGAGTTCAAGAAGCTCGACTACGATGCCCTGAAGAAGGACATCGCCGCCCTGATGACCGACTCGCAGGACTGGTGGCCTGCCGACTTC
GGCCACTATGGTGGTCTTTT
GTGAGTACCCTCGTCTCAATGGACTCGGAATGGTTTGCTAACGCCGTAACAGCATCCGCATGGCATGGCACAGTGCCGGTACCTACCGTGTCTCTGACGG
CCGCGGTGGCGGTGGTGAGGGCCAGCAGCGCTTTGCCCCCCTCAACGCCTGGCCTGACAACGTCTCGCTCGACAAGGCCCGTCGCCTGCTGTGGCCCATCAAGCAGAAGTACGGCAACAA
GATCTCGTGGGCCGACCTGATGCTCCTGACCGGCAACGTTGCTCTTGAGACCATGGACTGCCCAACCTTCGGCTTCGCTGGTGGCCGCGCCGACACATACCAGTCCGCTGAGGATGTCTA
CTGGGGCGGCGAGACCGAGTGGCTGGGCAATGACGTCCGCTACCACGACGGCAACAAGGGCGTTGAGGGTGAGGGCATTATGGACGGCGACCAGCATAAGAATGATGTTACCTCCAAGGA
GCAAGTGCACACACAGCGCGACCTCGAGAAGCCTCTCGCCGCTGCCCACATGGGTCTCATTTACGTCAACCCCGAGGGCCCTGACGGTGTCCCCGACCCAGTTGCTGCGGCCCACGACAT
CCGCACCACTTTCGGCCGCATGGCCATGAACGACGAGGAGACGGCTGCCCTGATCGTCGGTGGACACTCCTTCGGAAAAACACACGGTGCCGCGCCCTCCGATAACACCGGCACAGACCC
CAACGGCGCCGACCTTGCTGCGCAGGGTTTCGGTTGGGAGAACAAGCACGGCCGCGGCAACGGGCCCGACACCATCACATCCGGTCTCGAGGTCACCTGGACCGGCACACCCACCAAGTG
GAGCAACAAGTACCTCGAGTACCTGTACAAGTTCGAGTGGGAGCTTGAGAAGTCTCCTGCCGGTGCCAGCCAGTACGTTGCCAAGGGAGCTGATGCCATCATCCCCGATGCGTACGACTC
CAACAAGAAGCATAAGCCTCGCATGTTGACCACCGACTTGTCCATGCGCTTCGACCCTGCATACGAGAAGATCACCCGCCGCTGGTTGGAGCACCCCGAGGAGCTTCACGACGCTTTCAC
ACGCGCGTGGTTCAAGCTTCTCCACCGTGACATGGGTCCCCGCTCCAGGTGGCTCGGTCCCGAGCTCCCCAAGGAGGTCCTCATCTGGGAGGATCCCGTACCTGAGCAGCAGGGTGAGGT
CATCGGCGAGAGTGACATCTCGGCGCTGAAGAAGGAGATCCTTGACGCTGGTGTCGAGCCCTCAAAGCTCATCCGCGTTGCCTGGGCCTCCGCTGCCTCATTCCGTGGCTCTGACAAGCG
CGGTGGTGCCAATGGTGCTCGCATCCGCCTTGAGCCCCAGAAGAACTGGGAGGTCAACAACCCTGCTGAGCTCCAGGAGGTTCTCAAGGCTCTTGAGGGTGTCAAGTCCAAGTCCAGCAA
GAACGTTTCTCTTGCTGACTTGATCGTCCTCGCTGGTGTTGCCGCTCTCGAGAAGGCTTCTGGTGTATCCGTTCCGTTCACACCCGGCCGCACCGATGCGACCCAGGAGCAGACTGACGT
CCAGTCATTCGAGCACCTAGAACCCGTCACTGACGGTTTCCGCAACTACGGAAAGGGCACCGAGCGTGTCCGCACCGAGCAGTTGGATGTTGACAAGGCCAACCTCCTCAGGTTGACCGC
ACCCGAGATGACCGTTCTTGTTGGTGGTCTTCGTTCCTTGAACGCCAACTGGGACGGCTCTTCTCACGGTGTCTTCACTAAGCGCCCTGGTCAGCTCACCAACGACTTCTTCGTCAACCT
GCTCGACAACAATGTCGAATGGAAAGGTGCCGACTCCTCCAGCCCTCACGAGCTGTACGAGGGCAAGGACCGCAAGTCTGGACAGAAGAAGTGGACAGGAACCCGTCACGATCTGATTTT
CGGTTCGCACCCCGAGTTGCGATCCATCGCCGAGATCTACGCACAGCCGGATAACGCCGACAAGTTTGTCAAGGACTTCGTCGCCGCGTGGGACAAGGTTATGAATTTGGATCGTTACGA
TGTCAAGGCGAAAGCGGTGAGTGGCACATCAAGTGTTTCGAGCAGGCCTCGTCTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGCAGGCGAGTGTCCCATGAAGGCAGCCAACGTGTCTGGTGGCGGTACTCAGACACGCGACTGGTGGCCGAACGAGCTCAGGCTCAACGTCCTCCGCCAGCACGACCCCCGCCAG
GTTCCCTTTGGCCAGGACTTTGACTATGCTGAGGAGTTCAAGAAGCTCGACTACGATGCCCTGAAGAAGGACATCGCCGCCCTGATGACCGACTCGCAGGACTGGTGGCCTGCCGACTTC
GGCCACTATGGTGGTCTTTT
CATCCGCATGGCATGGCACAGTGCCGGTACCTACCGTGTCTCTGACGGCCGCGGTGGCGGTGGTGAGGGCCAGCAGCGCTTTGCCCCCCTCAACGCCTGG
CCTGACAACGTCTCGCTCGACAAGGCCCGTCGCCTGCTGTGGCCCATCAAGCAGAAGTACGGCAACAAGATCTCGTGGGCCGACCTGATGCTCCTGACCGGCAACGTTGCTCTTGAGACC
ATGGACTGCCCAACCTTCGGCTTCGCTGGTGGCCGCGCCGACACATACCAGTCCGCTGAGGATGTCTACTGGGGCGGCGAGACCGAGTGGCTGGGCAATGACGTCCGCTACCACGACGGC
AACAAGGGCGTTGAGGGTGAGGGCATTATGGACGGCGACCAGCATAAGAATGATGTTACCTCCAAGGAGCAAGTGCACACACAGCGCGACCTCGAGAAGCCTCTCGCCGCTGCCCACATG
GGTCTCATTTACGTCAACCCCGAGGGCCCTGACGGTGTCCCCGACCCAGTTGCTGCGGCCCACGACATCCGCACCACTTTCGGCCGCATGGCCATGAACGACGAGGAGACGGCTGCCCTG
ATCGTCGGTGGACACTCCTTCGGAAAAACACACGGTGCCGCGCCCTCCGATAACACCGGCACAGACCCCAACGGCGCCGACCTTGCTGCGCAGGGTTTCGGTTGGGAGAACAAGCACGGC
CGCGGCAACGGGCCCGACACCATCACATCCGGTCTCGAGGTCACCTGGACCGGCACACCCACCAAGTGGAGCAACAAGTACCTCGAGTACCTGTACAAGTTCGAGTGGGAGCTTGAGAAG
TCTCCTGCCGGTGCCAGCCAGTACGTTGCCAAGGGAGCTGATGCCATCATCCCCGATGCGTACGACTCCAACAAGAAGCATAAGCCTCGCATGTTGACCACCGACTTGTCCATGCGCTTC
GACCCTGCATACGAGAAGATCACCCGCCGCTGGTTGGAGCACCCCGAGGAGCTTCACGACGCTTTCACACGCGCGTGGTTCAAGCTTCTCCACCGTGACATGGGTCCCCGCTCCAGGTGG
CTCGGTCCCGAGCTCCCCAAGGAGGTCCTCATCTGGGAGGATCCCGTACCTGAGCAGCAGGGTGAGGTCATCGGCGAGAGTGACATCTCGGCGCTGAAGAAGGAGATCCTTGACGCTGGT
GTCGAGCCCTCAAAGCTCATCCGCGTTGCCTGGGCCTCCGCTGCCTCATTCCGTGGCTCTGACAAGCGCGGTGGTGCCAATGGTGCTCGCATCCGCCTTGAGCCCCAGAAGAACTGGGAG
GTCAACAACCCTGCTGAGCTCCAGGAGGTTCTCAAGGCTCTTGAGGGTGTCAAGTCCAAGTCCAGCAAGAACGTTTCTCTTGCTGACTTGATCGTCCTCGCTGGTGTTGCCGCTCTCGAG
AAGGCTTCTGGTGTATCCGTTCCGTTCACACCCGGCCGCACCGATGCGACCCAGGAGCAGACTGACGTCCAGTCATTCGAGCACCTAGAACCCGTCACTGACGGTTTCCGCAACTACGGA
AAGGGCACCGAGCGTGTCCGCACCGAGCAGTTGGATGTTGACAAGGCCAACCTCCTCAGGTTGACCGCACCCGAGATGACCGTTCTTGTTGGTGGTCTTCGTTCCTTGAACGCCAACTGG
GACGGCTCTTCTCACGGTGTCTTCACTAAGCGCCCTGGTCAGCTCACCAACGACTTCTTCGTCAACCTGCTCGACAACAATGTCGAATGGAAAGGTGCCGACTCCTCCAGCCCTCACGAG
CTGTACGAGGGCAAGGACCGCAAGTCTGGACAGAAGAAGTGGACAGGAACCCGTCACGATCTGATTTTCGGTTCGCACCCCGAGTTGCGATCCATCGCCGAGATCTACGCACAGCCGGAT
AACGCCGACAAGTTTGTCAAGGACTTCGTCGCCGCGTGGGACAAGGTTATGAATTTGGATCGTTACGATGTCAAGGCGAAAGCGGTGAGTGGCACATCAAGTGTTTCGAGCAGGCCTCGT
CTTTGA

Retrieve as FASTA