Entry information : DexiCIIAC02
Entry ID 12257
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: DexiCIIAC02
Name DexiCIIAC02
Class Asco Class II type C    [Orthogroup: CIIAC001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Didymellaceae Didymella
Organism Didymella exigua    [TaxId: 100019 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value DexiCIIAC02
start..stop
S start..stop
AbraCIIAC02 502 2e-180 1..340 1..347
LfluCIIAC02 502 2e-180 1..334 1..336
AalteCIIAC02 497 2e-178 7..340 7..346
PtritCIIAC01 494 3e-177 1..340 1..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 745129..745366 238 N° 2 744273..745078 806  
complement(join(744273..745078,745129..745366))


exon

Literature and cross-references DexiCIIAC02
DNA ref. JGI genome:   scaffold_12 (745366..744273)
Cluster/Prediction ref. JGI gene:   420305
Protein sequence: DexiCIIAC02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   348 (327)
PWM (Da):   %s   37808.41 (35503.0)  
PI (pH):   %s   8.36 (7.85) Peptide Signal:   %s   cut: 21 range:21-347
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFHKLILALPLLSLTFLALASPLEERQSIPGLIDNLLTGILSGVSQLIKNVLAGTTSGIDNAKSNKPPLCSSMIDSCCAWYDVSAELTKLFLQADGGCNDNARAAVRFGFHDAGAWDKTSPNGGADGSLLMNFGEIDRPENNGLQSIRGVLQGVQQKYRVGYADLVQYAHNHATVTCPKGPRIRTFVGRKDATKAAPTGLLPDVRDSADNLIALFERKGFSAHDLAALVGAHATAKQRFVDVSQAGKPLDTTPTVWDVEFYNDTLNQPTMPNDKIFVLPSDKVLSVHPKVNGEWKQFVGNQQHWNEDYSKAYIRMSLTGVTNLKDLRDCTKTLPASRPNFVAPKLRV*

Retrieve as FASTA  
Remarks complete sequence from genomics (1 intron)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCCACAAGCTCATATTAGCATTGCCCCTTCTTTCGCTCACCTTCCTCGCCCTGGCCAGCCCTCTGGAGGAACGCCAGAGTATACCTGGGCTGATTGATAACTTGTTGACGGGCATT
CTCTCGGGTGTTTCACAGCTTATCAAAAACGTGCTTGCTGGCACGACATCGGGCATCGACAACGCTAAATCGAACAAGCCGCCCCTCTGCTCATCAATGATCGACTCTTGCTGTGCAT
GT
ATGTTCACACAGTCTCTTTTCGAAAGACAGTACTGACCTCATCACAAGGGTACGATGTTTCAGCTGAGCTCACAAAACTGTTCTTGCAAGCAGACGGCGGGTGCAACGACAATGCTCGTG
CTGCCGTGCGATTTGGCTTCCACGACGCCGGTGCCTGGGACAAGACTTCGCCCAATGGCGGCGCTGATGGATCTCTCTTGATGAACTTTGGCGAGATAGACCGACCTGAGAACAACGGTT
TACAGAGTATTCGTGGAGTACTTCAAGGTGTACAACAGAAGTACAGAGTCGGATACGCCGACCTTGTTCAGTACGCCCACAACCACGCAACTGTCACCTGTCCGAAGGGACCACGCATCA
GGACCTTCGTCGGCCGCAAGGATGCAACAAAAGCTGCGCCTACTGGTCTGCTGCCAGATGTACGTGACAGCGCAGACAACCTCATCGCTCTCTTCGAACGCAAAGGGTTCTCCGCCCATG
ATCTCGCCGCACTCGTCGGTGCCCACGCAACAGCGAAGCAACGTTTCGTCGACGTATCTCAGGCCGGAAAGCCGCTTGACACCACCCCCACTGTCTGGGACGTCGAATTCTACAACGACA
CGCTGAACCAACCGACGATGCCCAACGACAAGATCTTTGTACTTCCCTCTGATAAGGTGCTGAGCGTACATCCTAAGGTCAACGGCGAGTGGAAGCAGTTCGTCGGCAACCAGCAACACT
GGAACGAGGACTACTCAAAAGCGTACATTAGGATGAGCCTGACAGGTGTGACAAACCTGAAAGACTTGAGGGACTGCACAAAGACGCTGCCTGCAAGCAGGCCGAACTTTGTGGCGCCGA
AGCTTCGAGTATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCCACAAGCTCATATTAGCATTGCCCCTTCTTTCGCTCACCTTCCTCGCCCTGGCCAGCCCTCTGGAGGAACGCCAGAGTATACCTGGGCTGATTGATAACTTGTTGACGGGCATT
CTCTCGGGTGTTTCACAGCTTATCAAAAACGTGCTTGCTGGCACGACATCGGGCATCGACAACGCTAAATCGAACAAGCCGCCCCTCTGCTCATCAATGATCGACTCTTGCTGTGCAT
GG
TACGATGTTTCAGCTGAGCTCACAAAACTGTTCTTGCAAGCAGACGGCGGGTGCAACGACAATGCTCGTGCTGCCGTGCGATTTGGCTTCCACGACGCCGGTGCCTGGGACAAGACTTCG
CCCAATGGCGGCGCTGATGGATCTCTCTTGATGAACTTTGGCGAGATAGACCGACCTGAGAACAACGGTTTACAGAGTATTCGTGGAGTACTTCAAGGTGTACAACAGAAGTACAGAGTC
GGATACGCCGACCTTGTTCAGTACGCCCACAACCACGCAACTGTCACCTGTCCGAAGGGACCACGCATCAGGACCTTCGTCGGCCGCAAGGATGCAACAAAAGCTGCGCCTACTGGTCTG
CTGCCAGATGTACGTGACAGCGCAGACAACCTCATCGCTCTCTTCGAACGCAAAGGGTTCTCCGCCCATGATCTCGCCGCACTCGTCGGTGCCCACGCAACAGCGAAGCAACGTTTCGTC
GACGTATCTCAGGCCGGAAAGCCGCTTGACACCACCCCCACTGTCTGGGACGTCGAATTCTACAACGACACGCTGAACCAACCGACGATGCCCAACGACAAGATCTTTGTACTTCCCTCT
GATAAGGTGCTGAGCGTACATCCTAAGGTCAACGGCGAGTGGAAGCAGTTCGTCGGCAACCAGCAACACTGGAACGAGGACTACTCAAAAGCGTACATTAGGATGAGCCTGACAGGTGTG
ACAAACCTGAAAGACTTGAGGGACTGCACAAAGACGCTGCCTGCAAGCAGGCCGAACTTTGTGGCGCCGAAGCTTCGAGTATAA

Retrieve as FASTA