Entry information : CgeoCcP01
Entry ID 12264
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: CgeoCcP01
Name CgeoCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Cenococcum
Organism Cenococcum geophilum    [TaxId: 5570 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgeoCcP01
start..stop
S start..stop
GsteCcP02 697 0 1..374 1..374
LpaluCcP02 662 0 1..373 1..373
HpulCcP02 600 0 1..374 1..370
RrufCcP02 580 0 1..372 1..371
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 151694..152100 407 N° 2 151513..151634 122 N° 3 150837..151432 596  
complement(join(150837..151432,151513..151634,151694..152100))


exon

Literature and cross-references CgeoCcP01
DNA ref. JGI genome:   scaffold_110 (152100..150837)
Cluster/Prediction ref. JGI gene:   624153
Protein sequence: CgeoCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   375
PWM (Da):   %s   41842.7 Transmb domain:   %s   i53-75o
PI (pH):   %s   8.06
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASAARPFTRGALRLAPANFRATATRNARFAVPRQTFPRQSRRGYADNAAPKSGSSGLLWGIGLAALGGGGFYYYSQNPDLFSGKEVKPKGPFTPKFEDYQQVYNTVAKALEEHDEYDDGSYGPVLLRLAWHASGTYDKETGTGGSNGATMRFTPEGDHGANAGLKAARDFLDPIEKFPWISYSDLWILSGICAIQEMQGPHIPFRPGRTDRDVSFCTPDGRLPDASQEQKHLRTIFGRMGFNDQEIVALSGAHALGRCHTDRSGYDGPWTFSPTTLTNDYYKLLIEEKWAWKKWSGPKQFEDVTTKSLMMLPTDMVLIKDKSFRQYVEKYAKDNDAFFKDFADVVTRLFELGVPFTTGEDARWTFKSSFDEA

Retrieve as FASTA  
Remarks complete sequence from genomics(2 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCGCAGCTAGGCCCTTCACCCGCGGCGCGCTGCGATTAGCCCCGGCAAACTTCAGGGCGACCGCCACACGCAACGCACGCTTCGCAGTTCCACGACAGACATTCCCCCGACAA
TCTCGTCGAGGATATGCCGATAATGCAGCACCGAAGTCTGGCAGCAGCGGCCTCCTGTGGGGCATTGGTCTTGCCGCCCTTGGTGGCGGAGGGTTCTACTACTACAGCCAGAACCCAGAC
CTCTTCTCAGGGAAGGAAGTTAAGCCAAAGGGTCCTTTCACTCCCAAGTTCGAGGACTACCAGCAGGTTTACAATACTGTGGCAAAGGCACTGGAGGAACATGATGAGTACGACGACGGC
AGCTATGGCCCCGTCCTGCTAAGATTGGCATGGCACGCCAGTGGAAC
GTAAGTAAAATAGGATCAATCGAGAGAGAAGGTGAAATTTGATGGCTAACATAAGATAGCTATGACAAGGAAA
CTGGCACTGGCGGCTCCAATGGTGCCACCATGAGATTCACCCCGGAGGGTGACCACGGTGCAAATGCTGGCCTGAAGGCTGCTCGCGACTTCCTAGATCCTATCAAGG
GTACGTCTACAC
ATCGGCAATTCCGATCTTCTCTTGGCCTCCCTATATCCCAAATTAACCCCCCTATTGACAATCTCTAGAAAAATTTCCTTGGATAAGCTACTCTGACCTCTGGATTCTTTCTGGCATCTG
CGCCATCCAAGAAATGCAAGGCCCACACATTCCCTTCCGTCCAGGTCGTACAGACCGCGACGTTTCCTTCTGTACTCCTGACGGTCGTCTCCCGGATGCCTCCCAGGAGCAGAAGCATCT
GCGCACTATCTTCGGCCGCATGGGTTTCAACGACCAAGAAATTGTTGCACTATCAGGTGCCCACGCTCTCGGGCGTTGCCACACTGACCGAAGTGGCTATGACGGCCCATGGACCTTCTC
GCCAACCACCCTCACCAACGACTACTACAAGCTCCTGATCGAGGAGAAGTGGGCATGGAAGAAGTGGAGCGGCCCCAAGCAGTTTGAGGACGTGACGACCAAGTCTCTCATGATGCTGCC
GACAGATATGGTGCTCATCAAAGACAAGAGCTTCAGGCAGTACGTAGAGAAGTATGCCAAGGACAATGATGCTTTCTTCAAGGACTTCGCGGATGTGGTAACAAGACTCTTCGAGCTGGG
TGTGCCGTTCACAACCGGCGAGGATGCGAGATGGACGTTCAAGAGCAGCTTCGACGAGGCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCGCAGCTAGGCCCTTCACCCGCGGCGCGCTGCGATTAGCCCCGGCAAACTTCAGGGCGACCGCCACACGCAACGCACGCTTCGCAGTTCCACGACAGACATTCCCCCGACAA
TCTCGTCGAGGATATGCCGATAATGCAGCACCGAAGTCTGGCAGCAGCGGCCTCCTGTGGGGCATTGGTCTTGCCGCCCTTGGTGGCGGAGGGTTCTACTACTACAGCCAGAACCCAGAC
CTCTTCTCAGGGAAGGAAGTTAAGCCAAAGGGTCCTTTCACTCCCAAGTTCGAGGACTACCAGCAGGTTTACAATACTGTGGCAAAGGCACTGGAGGAACATGATGAGTACGACGACGGC
AGCTATGGCCCCGTCCTGCTAAGATTGGCATGGCACGCCAGTGGAAC
CTATGACAAGGAAACTGGCACTGGCGGCTCCAATGGTGCCACCATGAGATTCACCCCGGAGGGTGACCACGGT
GCAAATGCTGGCCTGAAGGCTGCTCGCGACTTCCTAGATCCTATCAAGG
AAAAATTTCCTTGGATAAGCTACTCTGACCTCTGGATTCTTTCTGGCATCTGCGCCATCCAAGAAATGCAA
GGCCCACACATTCCCTTCCGTCCAGGTCGTACAGACCGCGACGTTTCCTTCTGTACTCCTGACGGTCGTCTCCCGGATGCCTCCCAGGAGCAGAAGCATCTGCGCACTATCTTCGGCCGC
ATGGGTTTCAACGACCAAGAAATTGTTGCACTATCAGGTGCCCACGCTCTCGGGCGTTGCCACACTGACCGAAGTGGCTATGACGGCCCATGGACCTTCTCGCCAACCACCCTCACCAAC
GACTACTACAAGCTCCTGATCGAGGAGAAGTGGGCATGGAAGAAGTGGAGCGGCCCCAAGCAGTTTGAGGACGTGACGACCAAGTCTCTCATGATGCTGCCGACAGATATGGTGCTCATC
AAAGACAAGAGCTTCAGGCAGTACGTAGAGAAGTATGCCAAGGACAATGATGCTTTCTTCAAGGACTTCGCGGATGTGGTAACAAGACTCTTCGAGCTGGGTGTGCCGTTCACAACCGGC
GAGGATGCGAGATGGACGTTCAAGAGCAGCTTCGACGAGGCGTGA

Retrieve as FASTA