Entry information : CgeoCIIAB01
Entry ID 12266
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: CgeoCIIAB01
Name CgeoCIIAB01
Class Asco Class II type B    [Orthogroup: CIIAB001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Cenococcum
Organism Cenococcum geophilum    [TaxId: 5570 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgeoCIIAB01
start..stop
S start..stop
GsteCIIAB01 532 0 1..316 1..315
HpulCIIAB01 403 3e-142 1..311 1..312
LpaluCIIAB01 380 3e-133 1..304 1..306
RrufCIIAB02 358 8e-125 2..311 3..312
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 464229..464464 236 N° 2 464002..464180 179 N° 3 463538..463943 406 N° 4 463310..463439 130
complement(join(463310..463439,463538..463943,464002..464180,464229..464464))


exon

Literature and cross-references CgeoCIIAB01
DNA ref. JGI genome:   scaffold_61 (464464..463310)
Cluster/Prediction ref. JGI gene:   620263
Protein sequence: CgeoCIIAB01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317
PWM (Da):   %s   33300.49  
PI (pH):   %s   5.09
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MYASAAVYFLAASGIAQAFRLPDASVLTRDLHIPSFSNIKRSISETLSPRASCPAVWSTISSNLTDLFLTSGQCNNLARQAIRAAFHDCFNNGCDGSLILAGEFSRPEDAGMADICSELTKIQAEHDVGMADLIQFAGAHAIRTCPLGPAVPAYVGRNDNSTAAPAGQLPPVNGSGDSLLAMFKKKEFTATDLAALIGAHSTSTQSFVDQSKAGESQDSTPGIWDVAYYGQTLTGTAPFTFESDKNLAAQEEVKPVFQSFVANQKGWDDAFVPAMVKMATLGVPGGISSLTDCTSALPGVTLKRDIKAAPMGAWKR*

Retrieve as FASTA  
Remarks complete sequence from genomics (3 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTATGCCTCAGCAGCTGTCTATTTCCTGGCCGCATCAGGGATCGCGCAAGCCTTCCGATTACCAGACGCCTCTGTATTGACCCGTGATCTCCACATACCGTCTTTCTCCAACATCAAG
CGTTCGATATCAGAAACGCTATCTCCCCGCGCCTCGTGCCCAGCCGTTTGGTCTACTATCTCCAGCAACCTCACTGATCTATTCCTCACGAGTGGACAATGTAACAACCTCGCACG
GTGC
GCCCAGACCATCTCTGCTATAACCACATTCTAACTCTGCTACAGCCAAGCCATCAGAGCAGCGTTCCACGACTGCTTCAATAATGGCTGCGATGGCTCTCTGATCCTCGCAGGCGAATTC
TCCAGGCCTGAAGACGCAGGAATGGCCGACATCTGCTCCGAACTCACCAAAATACAAGCGGAGCATGATGTCGGCATGGCAGACTTGATACAGTTTGCTGGCG
GTACGCGCATTCCCTTC
TCCTGCCTACCCCTGACCTTTAAAGTACTCACGCCTCCTAGCCCACGCCATCCGCACCTGCCCGCTTGGCCCTGCCGTGCCCGCCTACGTTGGCCGCAATGACAACAGCACCGCTGCCCC
TGCAGGGCAACTGCCGCCAGTCAACGGGTCGGGAGACTCGCTGCTGGCGATGTTCAAGAAGAAGGAGTTCACGGCGACGGACCTGGCGGCGCTGATAGGCGCGCACAGCACATCAACGCA
GTCTTTCGTGGATCAGTCCAAGGCTGGTGAGTCGCAGGACAGCACGCCTGGCATTTGGGACGTCGCGTATTATGGGCAGACGCTGACGGGTACGGCGCCGTTTACGTTTGAGAGCGATAA
GAACCTCGCGGCGCAGGAGGAAGTCAAGCCGGTGTTCCAGAGCTTTGTGGCGAATCAGAAGGGATGGGATGACGCGTTTGTGCCTGC
GTGAGTGTGGTTTTTTTCTCCCTTAATTTGGAG
GAGCTATATGAATCTTCTAGTTTAACATGTGTTGGTGTGGGTGTGTATGCTAACAGGGCTTGCAGTATGGTGAAAATGGCGACTCTCGGTGTGCCAGGCGGGATAAGCAGCCTGACTGAC
TGCACGAGCGCGCTGCCGGGTGTGACGCTGAAGCGGGATATCAAGGCCGCACCTATGGGTGCGTGGAAGAGGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTATGCCTCAGCAGCTGTCTATTTCCTGGCCGCATCAGGGATCGCGCAAGCCTTCCGATTACCAGACGCCTCTGTATTGACCCGTGATCTCCACATACCGTCTTTCTCCAACATCAAG
CGTTCGATATCAGAAACGCTATCTCCCCGCGCCTCGTGCCCAGCCGTTTGGTCTACTATCTCCAGCAACCTCACTGATCTATTCCTCACGAGTGGACAATGTAACAACCTCGCACG
CCAA
GCCATCAGAGCAGCGTTCCACGACTGCTTCAATAATGGCTGCGATGGCTCTCTGATCCTCGCAGGCGAATTCTCCAGGCCTGAAGACGCAGGAATGGCCGACATCTGCTCCGAACTCACC
AAAATACAAGCGGAGCATGATGTCGGCATGGCAGACTTGATACAGTTTGCTGGCG
CCCACGCCATCCGCACCTGCCCGCTTGGCCCTGCCGTGCCCGCCTACGTTGGCCGCAATGACAAC
AGCACCGCTGCCCCTGCAGGGCAACTGCCGCCAGTCAACGGGTCGGGAGACTCGCTGCTGGCGATGTTCAAGAAGAAGGAGTTCACGGCGACGGACCTGGCGGCGCTGATAGGCGCGCAC
AGCACATCAACGCAGTCTTTCGTGGATCAGTCCAAGGCTGGTGAGTCGCAGGACAGCACGCCTGGCATTTGGGACGTCGCGTATTATGGGCAGACGCTGACGGGTACGGCGCCGTTTACG
TTTGAGAGCGATAAGAACCTCGCGGCGCAGGAGGAAGTCAAGCCGGTGTTCCAGAGCTTTGTGGCGAATCAGAAGGGATGGGATGACGCGTTTGTGCCTGC
TATGGTGAAAATGGCGACT
CTCGGTGTGCCAGGCGGGATAAGCAGCCTGACTGACTGCACGAGCGCGCTGCCGGGTGTGACGCTGAAGCGGGATATCAAGGCCGCACCTATGGGTGCGTGGAAGAGGTGA

Retrieve as FASTA