Entry information : CgeoAPx-CcP02
Entry ID 12267
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: CgeoAPx-CcP02
Name CgeoAPx-CcP02
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Cenococcum
Organism Cenococcum geophilum    [TaxId: 5570 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgeoAPx-CcP02
start..stop
S start..stop
MphAPx-CcP 551 0 11..510 7..527
BdotAPx-CcP04 517 0 52..510 34..511
HanAPx-CcP04 491 9e-171 17..515 14..527
ShirAPx-CcP 472 4e-163 8..516 2..533
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4584551..4584947 397 N° 2 4583802..4584445 644 N° 3 4583699..4583720 22 N° 4 4583157..4583644 488
complement(join(4583157..4583644,4583699..4583720,4583802..4584445,4584551..4584 947))


exon

Literature and cross-references CgeoAPx-CcP02
DNA ref. JGI genome:   scaffold_4 (4584947..4583157)
Cluster/Prediction ref. JGI gene:   216923
Protein sequence: CgeoAPx-CcP02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   517 (490)
PWM (Da):   %s   53878.27 (50900.7)  
PI (pH):   %s   4.68 (4.57) Peptide Signal:   %s   cut: 27 range:27-516
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRAFLFSSFVLFLSLLPLSLLPSSHSAFHYPTALLSRLEHLLVDTDGAFRSGFKDAITPCSNYVSGSQLFGRQTSSQWLRVAFHDFVTAHIDEGTGGIDASIGFETLRSEDSGSAFNDSFAFFAPYVDARTSMADLVALSVVLSVGNCGGPQVPLRGGRIDATTGGAFGVPEPETNLTETLAEFASAGFNAADSIGLTACGHSLGRVHHGGFPQVVPASAVTANNTAGGINLDSTPAEFDVVVVREYLGGYGQRGGPLVTSDNVTARSDLRLYESDGNATMRALGASKEGFAATCEGLFERMVNTVPKEVVLSAVVTPLRVKPVNVSFDIDLAEDPLGGLVFGGSIVLRSDDERTASALSKTGSNIWGNTTFYPFSVTVPTNNSAPFALIISGSGIPSTTFKLQSAAFLIPSLTSATNNDLTISAAVLKGYAKGVVAVSAQIASPIPQQGTLAPAITSQSVDLVYSKSVGNYDIYSVALASDAAADLSKTSVDITAEFKGGSKVVDEYNLLTFLS

Retrieve as FASTA  
Remarks complete sequence from genomics (3 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGTGCTTTCCTATTCTCATCCTTCGTCCTCTTCCTCTCTCTCCTCCCCCTCTCTCTCCTCCCCTCCTCCCACTCCGCCTTCCACTACCCCACTGCGCTCCTCTCGCGCCTCGAACAC
CTCCTCGTCGACACTGATGGCGCCTTCCGGTCCGGCTTCAAAGATGCCATCACGCCGTGCTCCAACTACGTGTCCGGTTCGCAGCTCTTCGGCCGCCAGACCAGCTCACAATGGCTGCGC
GTCGCGTTCCACGATTTCGTAACAGCGCACATCGACGAAGGGACCGGTGGCATCGACGCCTCAATCGGCTTCGAGACGCTGCGGTCTGAAGACTCCGGCAGCGCGTTCAACGACAGCTTT
GCGTTCTTCGCGCCCTACGTCGACGCCCGCACATCGA
GTAAGAGGTCCCTCATCTCCCCCCCTTTCCCACCTCCCTTTCCCACCTCCTACTCCTTCTCCCCTCTCCGCCTACTCCGCCTC
CTCACGCTAACAAACCTCCCAGTGGCCGACCTCGTCGCCCTCTCCGTCGTCCTCAGCGTCGGCAACTGCGGCGGGCCGCAAGTCCCCCTGCGAGGCGGCCGCATCGACGCCACGACGGGC
GGCGCCTTCGGCGTGCCGGAGCCGGAAACCAACCTGACGGAAACGCTCGCCGAGTTCGCGAGCGCGGGCTTCAACGCCGCCGACAGCATCGGGCTGACAGCGTGCGGGCACTCGCTGGGC
CGCGTGCACCACGGCGGCTTCCCGCAAGTCGTGCCCGCGAGCGCCGTCACGGCCAACAACACGGCGGGCGGGATTAATCTGGATAGCACGCCGGCGGAGTTCGATGTCGTGGTGGTGCGC
GAGTATCTGGGGGGCTATGGGCAGCGGGGGGGCCCGCTGGTTACGAGCGATAATGTGACGGCGAGGAGTGATTTGAGGCTGTACGAGAGCGATGGAAATGCGACGATGAGGGCGCTCGGG
GCGAGTAAGGAGGGGTTTGCGGCGACGTGTGAGGGGCTGTTTGAGCGCATGGTCAATACGGTGCCGAAGGAGGTGGTGCTGAGTGCGGTGGTGACGCCGCTGCGGGTGAAGCCTGTGAAC
GTCAGTTTTGATATCGATTTGGCGGAGGATCCGCTCGGAGGGCTGGTGTTTGGTGGGAGTATCAGA
GTAAGTTCTTGCTCCTTTCTCTTGGATTATGGGATTGGGTCTAGGTCTTCTTGA
GTAGCTCTGATCAAAAGTGGCGCGTAGGTTCTAAGGTCAGATGATGAAAGTGCTCCTGCTACCATCCACTATTCCGTCTCTGCCGGAAGTAACCACTACTCAGGAACCGCATCTGCCCTA
TCTAAGACCGGCAGCAATATCTGGGGTAACACGACTTTCTATCCCTTCTCGGTAACCGTTCCGACCAACAACAGCGCCCCGTTTGCTCTCATCATCTCCGGTTCAGGCATTCCTTCCACG
ACCTTCAAACTGCAATCGGCAGCATTCCTCATCCCGTCCTTGACCTCGGCTACCAACAATGATCTGACGATTTCTGCGGCGGTGCTGAAAGGATATGCTAAGGGAGTTGTGGCCGTCTCC
GCCCAGATCGCTTCGCCTATACCGCAGCAAGGCACGCTTGCGCCCGCTATTACGTCTCAGAGTGTTGATCTAGTCTACTCAAAAAGTGTAGGAAACTACGATATTTATTCTGTGGCTTTG
GCAAGTGATGCAGCGGCGGATTTGTCGAAGACGAGCGTGGATATAACAGCAGAATTTAAGGGTGGTAGCAAGGTTGTGGATGAATATAATCTACTAACGTTTCTGAGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGTGCTTTCCTATTCTCATCCTTCGTCCTCTTCCTCTCTCTCCTCCCCCTCTCTCTCCTCCCCTCCTCCCACTCCGCCTTCCACTACCCCACTGCGCTCCTCTCGCGCCTCGAACAC
CTCCTCGTCGACACTGATGGCGCCTTCCGGTCCGGCTTCAAAGATGCCATCACGCCGTGCTCCAACTACGTGTCCGGTTCGCAGCTCTTCGGCCGCCAGACCAGCTCACAATGGCTGCGC
GTCGCGTTCCACGATTTCGTAACAGCGCACATCGACGAAGGGACCGGTGGCATCGACGCCTCAATCGGCTTCGAGACGCTGCGGTCTGAAGACTCCGGCAGCGCGTTCAACGACAGCTTT
GCGTTCTTCGCGCCCTACGTCGACGCCCGCACATCGA
TGGCCGACCTCGTCGCCCTCTCCGTCGTCCTCAGCGTCGGCAACTGCGGCGGGCCGCAAGTCCCCCTGCGAGGCGGCCGCATC
GACGCCACGACGGGCGGCGCCTTCGGCGTGCCGGAGCCGGAAACCAACCTGACGGAAACGCTCGCCGAGTTCGCGAGCGCGGGCTTCAACGCCGCCGACAGCATCGGGCTGACAGCGTGC
GGGCACTCGCTGGGCCGCGTGCACCACGGCGGCTTCCCGCAAGTCGTGCCCGCGAGCGCCGTCACGGCCAACAACACGGCGGGCGGGATTAATCTGGATAGCACGCCGGCGGAGTTCGAT
GTCGTGGTGGTGCGCGAGTATCTGGGGGGCTATGGGCAGCGGGGGGGCCCGCTGGTTACGAGCGATAATGTGACGGCGAGGAGTGATTTGAGGCTGTACGAGAGCGATGGAAATGCGACG
ATGAGGGCGCTCGGGGCGAGTAAGGAGGGGTTTGCGGCGACGTGTGAGGGGCTGTTTGAGCGCATGGTCAATACGGTGCCGAAGGAGGTGGTGCTGAGTGCGGTGGTGACGCCGCTGCGG
GTGAAGCCTGTGAACGTCAGTTTTGATATCGATTTGGCGGAGGATCCGCTCGGAGGGCTGGTGTTTGGTGGGAGTATCAGA
GTTCTAAGGTCAGATGATGAAAGAACCGCATCTGCCCTA
TCTAAGACCGGCAGCAATATCTGGGGTAACACGACTTTCTATCCCTTCTCGGTAACCGTTCCGACCAACAACAGCGCCCCGTTTGCTCTCATCATCTCCGGTTCAGGCATTCCTTCCACG
ACCTTCAAACTGCAATCGGCAGCATTCCTCATCCCGTCCTTGACCTCGGCTACCAACAATGATCTGACGATTTCTGCGGCGGTGCTGAAAGGATATGCTAAGGGAGTTGTGGCCGTCTCC
GCCCAGATCGCTTCGCCTATACCGCAGCAAGGCACGCTTGCGCCCGCTATTACGTCTCAGAGTGTTGATCTAGTCTACTCAAAAAGTGTAGGAAACTACGATATTTATTCTGTGGCTTTG
GCAAGTGATGCAGCGGCGGATTTGTCGAAGACGAGCGTGGATATAACAGCAGAATTTAAGGGTGGTAGCAAGGTTGTGGATGAATATAATCTACTAACGTTTCTGAGCTGA

Retrieve as FASTA