Entry information : SmaGPx01
Entry ID 12269
Creation 2013-05-30 (Christophe Dunand)
Last sequence changes 2016-02-17 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-08 (Christophe Dunand)
Peroxidase information: SmaGPx01
Name SmaGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Sordariaceae Sordaria
Organism Sordaria macrospora    [TaxId: 5147 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmaGPx01
start..stop
S start..stop
NtetGPx01_2509 380 4e-136 1..224 1..227
NcGPx01 372 5e-133 1..224 1..229
NdisGPx01 328 1e-116 58..224 1..167
StheGPx01 297 3e-103 9..224 31..237
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 38004..38217 214 N° 2 38302..38762 461  
join(38004..38217,38302..38762)


exon

Literature and cross-references SmaGPx01
Protein ref. UniProtKB:   F7W713
DNA ref. GenBank:   CABT02000037.1 (38004..38762)
Protein sequence: SmaGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   224
PWM (Da):   %s   24974.8  
PI (pH):   %s   9.48
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIPRCCHRSSAVALTRLVKPSQLPSISSHQQLQLPVSKPAFYHQPITPRHFATTTVNMSSATTFYDFKSLDKKGSELPLSTYQGKVVLVVNVASKCGFTPQYAGLESVYKEIKEKYPNDFEILGFPCNQFGGQEPGTEEEISSFCQLNYGVSFPIMKKVEVNGDNATPVYEWMKNEKPGLMGLKRIKWNFEKFLIGKDGKVKGRWASTTKPESLKDAILKELGE

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATACCCCGCTGCTGCCATCGTTCATCAGCCGTTGCACTCACTCGCCTTGTGAAACCATCACAACTACCCTCAATCTCATCTCATCAACAACTTCAACTGCCAGTCTCCAAACCAGCA
TTCTATCACCAACCAATCACTCCCAGACACTTCGCGACAACAACAGTCAACATGTCTTCCGCCACTACCTTTTACGACTTCAAGTCCCTCGACA
GTAAGCCACTCACTCACCCACCATTT
CTCTCATCATTCACTCATCACCTAACCCATACTAACCAACCCACCCCCCGCTTAACAGAGAAGGGCTCCGAACTCCCGCTCTCCACCTACCAAGGCAAAGTCGTCCTCGTCGTCAACGTT
GCCTCCAAGTGCGGCTTCACCCCGCAATACGCAGGCCTCGAGAGCGTCTACAAGGAGATCAAGGAGAAGTACCCCAACGACTTTGAGATCCTGGGTTTCCCGTGCAACCAGTTTGGCGGG
CAGGAGCCGGGAACCGAGGAGGAGATCAGCTCGTTCTGCCAGCTCAACTATGGCGTCTCGTTTCCCATCATGAAGAAGGTCGAGGTCAACGGCGACAACGCCACGCCCGTGTACGAGTGG
ATGAAGAACGAGAAGCCCGGCCTGATGGGGCTGAAGCGCATCAAGTGGAACTTTGAGAAGTTTTTGATTGGAAAGGATGGCAAGGTTAAGGGAAGGTGGGCGAGCACGACTAAGCCGGAG
AGTCTGAAGGATGCTATTCTTAAGGAGTTGGGCGAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATACCCCGCTGCTGCCATCGTTCATCAGCCGTTGCACTCACTCGCCTTGTGAAACCATCACAACTACCCTCAATCTCATCTCATCAACAACTTCAACTGCCAGTCTCCAAACCAGCA
TTCTATCACCAACCAATCACTCCCAGACACTTCGCGACAACAACAGTCAACATGTCTTCCGCCACTACCTTTTACGACTTCAAGTCCCTCGACA
AGAAGGGCTCCGAACTCCCGCTCTCC
ACCTACCAAGGCAAAGTCGTCCTCGTCGTCAACGTTGCCTCCAAGTGCGGCTTCACCCCGCAATACGCAGGCCTCGAGAGCGTCTACAAGGAGATCAAGGAGAAGTACCCCAACGACTTT
GAGATCCTGGGTTTCCCGTGCAACCAGTTTGGCGGGCAGGAGCCGGGAACCGAGGAGGAGATCAGCTCGTTCTGCCAGCTCAACTATGGCGTCTCGTTTCCCATCATGAAGAAGGTCGAG
GTCAACGGCGACAACGCCACGCCCGTGTACGAGTGGATGAAGAACGAGAAGCCCGGCCTGATGGGGCTGAAGCGCATCAAGTGGAACTTTGAGAAGTTTTTGATTGGAAAGGATGGCAAG
GTTAAGGGAAGGTGGGCGAGCACGACTAAGCCGGAGAGTCTGAAGGATGCTATTCTTAAGGAGTTGGGCGAGTAA

Retrieve as FASTA