Entry information : CgeoGPx01
Entry ID 12270
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: CgeoGPx01
Name CgeoGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Cenococcum
Organism Cenococcum geophilum    [TaxId: 5570 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgeoGPx01
start..stop
S start..stop
GsteGPx01 332 3e-119 1..171 1..171
LpaluGPx01 317 5e-112 1..171 67..237
HpulGPx01 289 3e-101 1..167 57..223
BdotGPx01 289 8e-101 1..166 91..257
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5482929..5482971 43 N° 2 5482391..5482860 470  
complement(join(5482391..5482860,5482929..5482971))


exon

Literature and cross-references CgeoGPx01
DNA ref. JGI genome:   scaffold_1 (5482971..5482391)
Cluster/Prediction ref. JGI gene:   650632
Protein sequence: CgeoGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   172
PWM (Da):   %s   19377  
PI (pH):   %s   8.82
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASATSFFDFKPKDKKGNEYPLAPLKNKVILIVNTASKCGFTPQFTSLEKLYKDLQTTHPDFIILGFPCNQFGGQDPGSNEEIQEFCQINYGVSFPMLGKIDVNGEKAEPLWEWLKSERPGLMGLKRVKWNFEKFLIGRDGKVKGRWASTTKPENLREAIEKELVVKPTE

Retrieve as FASTA  
Remarks complete sequence from genomics (1 intron)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCGCAACCTCTTTCTTCGACTTCAAGCCCAAAGACAGTAAGTTCTTTCCAGCTACCTGTTACTCTTCACCGTTATCAGGCCTCTAACACACCTTACCTGCACAGAAAAGGGCA
ATGAATACCCTCTTGCACCGCTCAAGAACAAAGTGATCCTCATCGTTAACACCGCGTCCAAGTGTGGCTTCACGCCACAGTTCACCAGTCTCGAGAAACTATACAAAGACCTCCAGACGA
CCCACCCAGATTTCATTATCCTCGGCTTCCCCTGCAATCAGTTCGGTGGTCAGGATCCGGGCTCTAACGAGGAGATCCAGGAGTTCTGCCAGATCAATTATGGCGTGAGCTTCCCCATGC
TCGGCAAGATCGACGTGAATGGTGAGAAGGCAGAGCCATTATGGGAGTGGCTGAAGAGTGAGAGGCCTGGATTGATGGGCTTGAAGAGAGTGAAGTGGAATTTCGAGAAGTTTTTGATTG
GGAGAGACGGCAAGGTTAAGGGCAGGTGGGCAAGCACCACAAAGCCAGAGAACTTAAGGGAGGCGATTGAGAAGGAGTTGGTTGTAAAGCCAACCGAGGCA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCGCAACCTCTTTCTTCGACTTCAAGCCCAAAGACAAAAAGGGCAATGAATACCCTCTTGCACCGCTCAAGAACAAAGTGATCCTCATCGTTAACACCGCGTCCAAGTGTGGC
TTCACGCCACAGTTCACCAGTCTCGAGAAACTATACAAAGACCTCCAGACGACCCACCCAGATTTCATTATCCTCGGCTTCCCCTGCAATCAGTTCGGTGGTCAGGATCCGGGCTCTAAC
GAGGAGATCCAGGAGTTCTGCCAGATCAATTATGGCGTGAGCTTCCCCATGCTCGGCAAGATCGACGTGAATGGTGAGAAGGCAGAGCCATTATGGGAGTGGCTGAAGAGTGAGAGGCCT
GGATTGATGGGCTTGAAGAGAGTGAAGTGGAATTTCGAGAAGTTTTTGATTGGGAGAGACGGCAAGGTTAAGGGCAGGTGGGCAAGCACCACAAAGCCAGAGAACTTAAGGGAGGCGATT
GAGAAGGAGTTGGTTGTAAAGCCAACCGAGGCA

Retrieve as FASTA