Entry information : ApruGPx01
Entry ID 12271
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: ApruGPx01
Name ApruGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Botryosphaeriaceae Aplosporella
Organism Aplosporella prunicola    [TaxId: 462254 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ApruGPx01
start..stop
S start..stop
BdotGPx01 298 3e-104 1..170 91..260
Ssrc1lsm3aGPx01 283 8e-100 1..170 1..170
PnoGPx 282 1e-98 1..170 55..224
GsteGPx01 279 3e-98 1..167 1..166
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 73019..73061 43 N° 2 72373..72842 470  
complement(join(72373..72842,73019..73061))


exon

Literature and cross-references ApruGPx01
DNA ref. JGI genome:   scaffold_16 (73061..72373)
Cluster/Prediction ref. JGI gene:   288552
Protein sequence: ApruGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   171
PWM (Da):   %s   18759.53  
PI (pH):   %s   8.01
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASATSFYDFKPLDKRGQPFPLDSLKGKVVLVVNTASKCGFTPQFAGLESLYKDTRAAYGDDFVILGFPCNQFGNQDPGSNDTIQEFCQLNYGVSFPVLGKIDVNGEEAAPVFEWLKKEMPGLMGLKRVKWNFEKFLVGRDGTVKGRWASTTKPESLKEVVEKELTGGKA

Retrieve as FASTA  
Remarks complete sequence from genomics (1 intron)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTGCGACGAGCTTTTACGACTTTAAGCCGCTGGATAGTGAGTCCATCTGCTTGATTTTCTTGCGTTGCCTTGTCATGCACGTTTGCCGTCGCTGCAAGTGTCTCCAGCGTCCT
CGCACACCGCCTTGGCTCGCATCGCACCACCACCACCATCACCACCCCACCGCACTCGCCATCCACGCACAACGCGCTAACCAGCACCACCACACACAGAGCGCGGCCAGCCCTTCCCGC
TCGACTCGCTCAAAGGCAAAGTCGTGCTCGTCGTCAACACCGCCTCCAAATGCGGCTTCACGCCGCAATTCGCCGGACTCGAGTCCCTATACAAAGACACGCGCGCGGCGTACGGCGACG
ACTTCGTCATCCTCGGCTTCCCCTGCAACCAGTTCGGCAACCAGGACCCCGGCTCCAACGACACGATCCAGGAGTTCTGCCAGCTGAACTACGGCGTCAGCTTCCCCGTGCTCGGGAAAA
TCGATGTCAATGGCGAGGAGGCGGCGCCCGTGTTTGAGTGGCTCAAGAAGGAGATGCCTGGCTTGATGGGCCTGAAGCGCGTTAAGTGGAATTTTGAGAAGTTCCTTGTCGGCAGGGATG
GCACTGTTAAGGGCCGTTGGGCGAGTACCACGAAGCCGGAGAGCCTGAAGGAGGTTGTCGAGAAGGAGCTGACGGGCGGGAAGGCGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTGCGACGAGCTTTTACGACTTTAAGCCGCTGGATAAGCGCGGCCAGCCCTTCCCGCTCGACTCGCTCAAAGGCAAAGTCGTGCTCGTCGTCAACACCGCCTCCAAATGCGGC
TTCACGCCGCAATTCGCCGGACTCGAGTCCCTATACAAAGACACGCGCGCGGCGTACGGCGACGACTTCGTCATCCTCGGCTTCCCCTGCAACCAGTTCGGCAACCAGGACCCCGGCTCC
AACGACACGATCCAGGAGTTCTGCCAGCTGAACTACGGCGTCAGCTTCCCCGTGCTCGGGAAAATCGATGTCAATGGCGAGGAGGCGGCGCCCGTGTTTGAGTGGCTCAAGAAGGAGATG
CCTGGCTTGATGGGCCTGAAGCGCGTTAAGTGGAATTTTGAGAAGTTCCTTGTCGGCAGGGATGGCACTGTTAAGGGCCGTTGGGCGAGTACCACGAAGCCGGAGAGCCTGAAGGAGGTT
GTCGAGAAGGAGCTGACGGGCGGGAAGGCGTAG

Retrieve as FASTA