Entry information : ApruCcP02
Entry ID 12273
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: ApruCcP02
Name ApruCcP02
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Botryosphaeriaceae Aplosporella
Organism Aplosporella prunicola    [TaxId: 462254 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ApruCcP02
start..stop
S start..stop
BdotCcP02 551 0 2..318 3..319
MdurCcP02 526 0 1..318 1..319
HpulCcP 520 0 1..318 1..318
AresCcP01 517 0 1..318 1..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 98423..98532 110 N° 2 98660..99506 847  
join(98423..98532,98660..99506)


exon

Literature and cross-references ApruCcP02
DNA ref. JGI genome:   scaffold_28 (98423..99506)
Cluster/Prediction ref. JGI gene:   312209
Protein sequence: ApruCcP02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319
PWM (Da):   %s   35120.57  
PI (pH):   %s   6.36
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSNPGDYDAVRQDIVTLLHQPEYDDGSAGPILVRLAWHSAGTYDAETDTGGSNGAGMRWEAEGGDPANAGLQHARVFLEPLKAKHSWITYSDLWTLAGTVAVKHMGGPEVSWLPGRTDFVDDSKLPPRGRLPDGALGADHLRHIFHRMGFSDQEIVALSGAHNLGRCHADRSGFEGAWVNNPTRFSNQYYKLLLTLEWKPKTLPSGIRQFAYVDEDTETELMMLPTDMALISDPAFRPWVEKYAKDRDAFFADFAKVFAKLIELGIERDASGKILNTDNTKGGYVSAPKKSSKPGAPAKSNEEAEPLRKENAKYRARL

Retrieve as FASTA  
Remarks complete sequence from genomics (1 intron)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCAATCCCGGCGACTACGACGCCGTCCGCCAGGACATTGTCACGCTTCTGCACCAGCCCGAGTACGACGACGGAAGCGCAGGCCCGATCCTCGTCCGTCTGGCCTGGTGAGTCCAT
CTCCAGCCATCCCCGAGACCTCCGTTCCTTTCCCTAGGAGGCGGCGACATCACACGACACGACACGACACGTCACACGTCACGCAAGCGCATAGCTGACGGACACACGTACGGGCAGGCA
CTCGGCGGGAACATATGACGCCGAGACGGACACGGGCGGCAGCAACGGCGCGGGGATGCGTTGGGAAGCGGAAGGCGGCGACCCTGCCAACGCGGGCCTGCAGCACGCGCGTGTCTTCCT
GGAGCCGCTCAAGGCCAAGCACAGCTGGATTACGTACTCGGACCTGTGGACGCTGGCTGGGACCGTGGCCGTCAAGCACATGGGCGGGCCCGAGGTCTCGTGGCTGCCTGGGCGCACCGA
CTTTGTCGACGACAGCAAGCTCCCACCGCGGGGACGGCTGCCCGACGGCGCGCTCGGCGCTGACCACCTGCGCCACATCTTCCACCGCATGGGCTTCTCGGACCAGGAGATCGTGGCGCT
GTCCGGCGCACATAATCTGGGGCGCTGCCATGCGGACCGCTCGGGCTTCGAGGGCGCCTGGGTCAATAACCCTACCCGCTTCAGCAACCAGTACTACAAGCTGCTGCTGACGCTGGAGTG
GAAGCCCAAGACGCTGCCATCGGGCATACGCCAATTCGCCTACGTCGACGAGGACACGGAGACGGAGCTCATGATGTTGCCCACGGATATGGCGCTCATCTCGGATCCGGCGTTTCGCCC
TTGGGTCGAGAAGTACGCCAAGGATCGCGATGCCTTCTTTGCGGATTTTGCAAAGGTCTTCGCAAAGCTCATCGAGCTGGGCATCGAGCGCGACGCGAGTGGCAAGATCCTGAACACGGA
TAACACCAAGGGCGGCTATGTCAGTGCGCCGAAGAAGAGCTCGAAGCCTGGCGCCCCGGCTAAGAGCAATGAGGAGGCGGAGCCGCTCAGAAAGGAGAACGCAAAGTACAGAGCGCGGTT
GTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCAATCCCGGCGACTACGACGCCGTCCGCCAGGACATTGTCACGCTTCTGCACCAGCCCGAGTACGACGACGGAAGCGCAGGCCCGATCCTCGTCCGTCTGGCCTGGCACTCGGCG
GGAACATATGACGCCGAGACGGACACGGGCGGCAGCAACGGCGCGGGGATGCGTTGGGAAGCGGAAGGCGGCGACCCTGCCAACGCGGGCCTGCAGCACGCGCGTGTCTTCCTGGAGCCG
CTCAAGGCCAAGCACAGCTGGATTACGTACTCGGACCTGTGGACGCTGGCTGGGACCGTGGCCGTCAAGCACATGGGCGGGCCCGAGGTCTCGTGGCTGCCTGGGCGCACCGACTTTGTC
GACGACAGCAAGCTCCCACCGCGGGGACGGCTGCCCGACGGCGCGCTCGGCGCTGACCACCTGCGCCACATCTTCCACCGCATGGGCTTCTCGGACCAGGAGATCGTGGCGCTGTCCGGC
GCACATAATCTGGGGCGCTGCCATGCGGACCGCTCGGGCTTCGAGGGCGCCTGGGTCAATAACCCTACCCGCTTCAGCAACCAGTACTACAAGCTGCTGCTGACGCTGGAGTGGAAGCCC
AAGACGCTGCCATCGGGCATACGCCAATTCGCCTACGTCGACGAGGACACGGAGACGGAGCTCATGATGTTGCCCACGGATATGGCGCTCATCTCGGATCCGGCGTTTCGCCCTTGGGTC
GAGAAGTACGCCAAGGATCGCGATGCCTTCTTTGCGGATTTTGCAAAGGTCTTCGCAAAGCTCATCGAGCTGGGCATCGAGCGCGACGCGAGTGGCAAGATCCTGAACACGGATAACACC
AAGGGCGGCTATGTCAGTGCGCCGAAGAAGAGCTCGAAGCCTGGCGCCCCGGCTAAGAGCAATGAGGAGGCGGAGCCGCTCAGAAAGGAGAACGCAAAGTACAGAGCGCGGTTGTAA

Retrieve as FASTA