Entry information : ApruCIIAB01
Entry ID 12274
Creation 2013-05-30 (Nizar Fawal)
Last sequence changes 2013-05-30 (Nizar Fawal)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: ApruCIIAB01
Name ApruCIIAB01
Class Asco Class II type B    [Orthogroup: CIIAB001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Botryosphaeriaceae Aplosporella
Organism Aplosporella prunicola    [TaxId: 462254 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ApruCIIAB01
start..stop
S start..stop
BdotCIIAB03 369 2e-129 1..296 1..312
HpulCIIAB01 314 2e-107 1..296 1..316
RrufCIIAB02 304 1e-103 29..296 48..316
GsteCIIAB01 296 9e-101 1..295 1..313
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 322259..322341 83 N° 2 322366..322646 281 N° 3 322709..323114 406 N° 4 323191..323311 121
join(322259..322341,322366..322646,322709..323114,323191..323311)


exon

Literature and cross-references ApruCIIAB01
DNA ref. JGI genome:   scaffold_20 (322259..323311)
Cluster/Prediction ref. JGI gene:   352586
Protein sequence: ApruCIIAB01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   297
PWM (Da):   %s   30791.32  
PI (pH):   %s   5.33
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MYISKPSVLYFLATATAGAQAFSFNEAVLKPRASCPSVWNDVVSELNGLFVSGGQCNDDARAAIRLSFHDCFSGAGCDGSLVLAQEYTRSENAGLQDISLKVGDLANKYNVGVADMIQFAGAVATTACPLGPRIRVLVGRTDSSTPAPEGDLPNDKASASTLISQFQAKGFSATDLAALVGAHSAAKQFNAIPEKSGQSLDSTPGTWDTKFYSETLNGKAPVSLDSDINLSNDSRTSGSFKVFAAGQAAWAVAYVNAMNKMTVLGNNVGNLTDCTSLLIGGTSKRDVKAADIAGRI*

Retrieve as FASTA  
Remarks complete sequence from genomics (3 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTATATCTCCAAGCCTTCTGTTCTCTACTTCCTCGCCACTGCCACCGCCGGTGCGCAGGCCTTCTCCTTCAATGAGGCAGTGTCCTTTCTCAAGCGCGATGTCAGCCTAAAGCCGCGA
GCCTCCTGTCCCTCCGTATGGAATGATGTGGTCAGCGAGCTCAACGGCTTGTTCGTGTCTGGCGGACAGTGCAACGACGATGCTCGCGCGGCCATTCGCCTGAGCTTCCACGACTGTTTC
TCTGGTGCTGGATGTGACGGCTCGCTCGTCTTGGCCCAAGAGTACACCCGCTCAGAGAACGCAGGCCTGCAGGATATTTCTCTCAAAGTCGGTGATCTGGCAAATAAGTACAACGTCGGT
GTAGCAGACATGATCCAGTTTGCTGGTG
GTATGTTTTCCACAAACCCAGTATCTCGCGAAGACGAGCATCATAATGACTTATAATTACAGCGGTTGCAACCACAGCCTGTCCCCTCGGTC
CACGCATTCGGGTCCTCGTTGGCCGCACAGATTCCAGCACGCCTGCCCCCGAAGGCGATCTGCCCAACGACAAAGCTTCCGCATCTACGCTGATCAGCCAATTCCAAGCCAAAGGCTTCA
GTGCCACTGACCTCGCAGCACTGGTGGGCGCACACAGCGCGGCAAAGCAGTTCAATGCAATTCCAGAAAAGTCGGGCCAGTCGCTTGACTCGACGCCTGGCACATGGGACACCAAGTTCT
ACTCGGAAACGCTTAATGGCAAAGCACCCGTCAGCCTTGATAGCGATATCAACCTTTCCAATGACTCTAGGACTAGTGGCAGCTTCAAGGTCTTCGCAGCCGGACAGGCAGCGTGGGCTG
TTGCATATGTCAATGC
GTGAGTGACCCTCTTTTCCTTCTCAATCTTTCTGTACGTATTAAGTGAACAACATGGCTGACGGTGAACCTCACAGCATGAACAAGATGACGGTTCTGGGCAAC
AACGTTGGAAACCTGACCGATTGCACCAGCCTTCTCATTGGTGGCACCAGTAAACGCGATGTTAAGGCTGCGGATATCGCAGGCAGGATATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTATATCTCCAAGCCTTCTGTTCTCTACTTCCTCGCCACTGCCACCGCCGGTGCGCAGGCCTTCTCCTTCAATGAGGCAGTCCTAAAGCCGCGAGCCTCCTGTCCCTCCGTATGGAAT
GATGTGGTCAGCGAGCTCAACGGCTTGTTCGTGTCTGGCGGACAGTGCAACGACGATGCTCGCGCGGCCATTCGCCTGAGCTTCCACGACTGTTTCTCTGGTGCTGGATGTGACGGCTCG
CTCGTCTTGGCCCAAGAGTACACCCGCTCAGAGAACGCAGGCCTGCAGGATATTTCTCTCAAAGTCGGTGATCTGGCAAATAAGTACAACGTCGGTGTAGCAGACATGATCCAGTTTGCT
GGTG
CGGTTGCAACCACAGCCTGTCCCCTCGGTCCACGCATTCGGGTCCTCGTTGGCCGCACAGATTCCAGCACGCCTGCCCCCGAAGGCGATCTGCCCAACGACAAAGCTTCCGCATCT
ACGCTGATCAGCCAATTCCAAGCCAAAGGCTTCAGTGCCACTGACCTCGCAGCACTGGTGGGCGCACACAGCGCGGCAAAGCAGTTCAATGCAATTCCAGAAAAGTCGGGCCAGTCGCTT
GACTCGACGCCTGGCACATGGGACACCAAGTTCTACTCGGAAACGCTTAATGGCAAAGCACCCGTCAGCCTTGATAGCGATATCAACCTTTCCAATGACTCTAGGACTAGTGGCAGCTTC
AAGGTCTTCGCAGCCGGACAGGCAGCGTGGGCTGTTGCATATGTCAATGC
CATGAACAAGATGACGGTTCTGGGCAACAACGTTGGAAACCTGACCGATTGCACCAGCCTTCTCATTGGT
GGCACCAGTAAACGCGATGTTAAGGCTGCGGATATCGCAGGCAGGATATAG

Retrieve as FASTA